AMPDB_1046 | Beta-defensin 8

PEPTIDE SUMMARY

Beta-defensin 8

1 General Description

AMPDB ID: AMPDB_1046

Protein Names: Beta-defensin 8 (BD-8) (mBD-8) (Defensin; beta 8) (Defensin-related peptide) (Defr1)

Protein Family: Beta-defensin family

Gene Name: Defb8

Source Organism: Mus musculus (Mouse)

Protein Length: 60 AA

Protein Existence: Evidence at protein level

2 Protein Sequence & Composition

2.1 Sequence

MRIHYLLFTFLLVLLSPLAAFSQKINEPVSCIRNGGICQYRCIGLRHKIGTCGSPFKCCK

FASTA format

2.2 Composition

Counts of Amino Acids

'A': 2, 'R': 4, 'N': 2, 'D': 0, 'C': 6, 'Q': 2, 'E': 1, 'G': 5, 'H': 2, 'I': 6, 'L': 8, 'K': 4, 'M': 1, 'F': 4, 'P': 3, 'S': 4, 'T': 2, 'W': 0, 'Y': 2, 'V': 2

Frequencies of Amino Acids

'A': 3.33%, 'R': 6.67%, 'N': 3.33%, 'D': 0%, 'C': 10%, 'Q': 3.33%, 'E': 1.67%, 'G': 8.33%, 'H': 3.33%, 'I': 10%, 'L': 13.33%, 'K': 6.67%, 'M': 1.67%, 'F': 6.67%, 'P': 5%, 'S': 6.67%, 'T': 3.33%, 'W': 0%, 'Y': 3.33%, 'V': 3.33%

Missing Amino Acid(s)

D, W

Most Occurring Amino Acid(s)

Less Occurring Amino Acid(s)

E, M

Hydrophobic Amino Acid(s) Count

Hydrophilic Amino Acid(s) Count

Basic Amino Acid(s) Count

Acidic Amino Acid(s) Count

Modified Amino Acid(s) Count

Modified Amino Acid(s) Frequencies

Computed by biopython (version 1.79) & proteinAnalysis (version 1)

3 Physicochemical Properties

Sl. No.	Properties	Values	Reference
1.	Molecular Mass	6760.2 Da	Computed by ProtParam module (biopython 1.79)
2.	Aliphatic Index	104	Computed by ProtParam module (biopython 1.79)
3.	Instability Index (Half Life)	51.412	Computed by ProtParam module (biopython 1.79)
4.	Hydrophobicity (GRAVY)	0.433	Computed by ProtParam module (biopython 1.79)
5.	Hydrophobic Moment	0.553	Computed by ProtParam module (biopython 1.79)
6.	Isoelectric Point	9.525	Computed by ProtParam module (biopython 1.79)
7.	Charge (at pH 7)	6.807	Computed by ProtParam module (biopython 1.79)
8.	Secondary Structure Fraction	0.367, 0.233, 0.2 [Helix, Turn, Sheet]	Computed by ProtParam module (biopython 1.79)
9.	Aromaticity	0.1	Computed by ProtParam module (biopython 1.79)
10.	Molar Extinction Coefficient (cysteine\|cystine)	2980, 3355	Computed by ProtParam module (biopython 1.79)

4 Activity Details

4.1 Target Organism(s)

B.cepacia (Gram-negative), E.coli (Gram-negative), P.aeruginosa (Gram-negative), S.aureus (Gram-positive)

4.2 Antimicrobial Activity

Antibiotic, Antimicrobial, Defensin, Anti-gram-negative, Anti-gram-Positive

4.3 Enzymatic Activity

Not found

4.4 Inhibitory Effect

Not found

4.5 Other Biological Activity

Non-hemolytic, Non-ribosomal

Activity data manually curated from Literature and UniProt

5 Database Cross-references

5.1 Literature Database

5.1.1 PubMed

Citation 1: Morrison GM, Rolfe M, Kilanowski FM, et al. Identification and characterization of a novel murine beta-defensin-related gene. Mamm Genome. 2002;13(8):445-51. Published 2002 Aug. doi:10.1007/s00335-002-3014-5

PMID: 12226710

Citation 2: Bauer F, Schweimer K, KlÃ¼ver E, et al. Structure determination of human and murine beta-defensins reveals structural conservation in the absence of significant sequence similarity. Protein Sci. 2001;10(12):2470-9. Published 2001 Dec. doi:10.1110/ps.24401

PMID: 11714914

5.2 Protein Sequence Databases

UniProt: Q91V82

5.3 3D Structure Databases

	Sl. no.	PDB ID	Method	Resolution	Access Links	3D View

AlphaFoldDB: Q91V82

5.4 Nucleotide Sequence Databases

Sl. no.	Accession(s)	Access Link(s)
1.	AJ344114	GenBank \|\| EMBL
2.	AJ300674	GenBank \|\| EMBL
3.	AJ300673	GenBank \|\| EMBL

CCDS: Not found

RefSeq: NP_694748.3

5.5 Protein-Protein Interaction Databases

STRING: 10090.ENSMUSP00000033854

IntAct: Not found

MINT: Not found

DIP: Not found

BioGRID: Not found

5.6 Ligand Databases

BindingDB: Not found

DrugBank: Not found

ChEMBL: Not found

5.7 Family & Domain Databases

InterPro: IPR001855

PANTHER: Not found

PROSITE: Not found

5.8 Genome Annotation Databases

Ensembl: Not found

KEGG: mmu:244334

5.9 Phylogenomic Databases

GeneTree: Not found

5.10 Enzyme & Pathway Databases

BRENDA: Not found

BioCyc: Not found

5.11 Protein-RNA Interaction Databases

RNAct: Q91V82

Download