AMPDB_1045 | PYLa PGLa B

PEPTIDE SUMMARY

PYLa PGLa B

1 General Description

AMPDB ID: AMPDB_1045

Protein Names: PYLa PGLa B [Cleaved into: PYLa; PGLa; PGLa-H]

Protein Family: Gastrin cholecystokinin family; Magainin subfamily

Gene Name: pgla-b pyla

Source Organism: Xenopus laevis (African clawed frog)

Protein Length: 64 AA

Protein Existence: Evidence at protein level

2 Protein Sequence & Composition

2.1 Sequence

MYKQIFLCLIIAALCATIMAEASALADADDDDDKRYVRGMASKAGAIAGKIAKVALKALGRRDS

FASTA format

2.2 Composition

Counts of Amino Acids

'A': 15, 'R': 4, 'N': 0, 'D': 7, 'C': 2, 'Q': 1, 'E': 1, 'G': 4, 'H': 0, 'I': 6, 'L': 6, 'K': 6, 'M': 3, 'F': 1, 'P': 0, 'S': 3, 'T': 1, 'W': 0, 'Y': 2, 'V': 2

Frequencies of Amino Acids

'A': 23.44%, 'R': 6.25%, 'N': 0%, 'D': 10.94%, 'C': 3.13%, 'Q': 1.56%, 'E': 1.56%, 'G': 6.25%, 'H': 0%, 'I': 9.38%, 'L': 9.38%, 'K': 9.38%, 'M': 4.69%, 'F': 1.56%, 'P': 0%, 'S': 4.69%, 'T': 1.56%, 'W': 0%, 'Y': 3.13%, 'V': 3.13%

Missing Amino Acid(s)

H, N, P, W

Most Occurring Amino Acid(s)

Less Occurring Amino Acid(s)

E, F, Q, T

Hydrophobic Amino Acid(s) Count

Hydrophilic Amino Acid(s) Count

Basic Amino Acid(s) Count

Acidic Amino Acid(s) Count

Modified Amino Acid(s) Count

Modified Amino Acid(s) Frequencies

Computed by biopython (version 1.79) & proteinAnalysis (version 1)

3 Physicochemical Properties

Sl. No.	Properties	Values	Reference
1.	Molecular Mass	6760.97 Da	Computed by ProtParam module (biopython 1.79)
2.	Aliphatic Index	105.625	Computed by ProtParam module (biopython 1.79)
3.	Instability Index (Half Life)	28.045	Computed by ProtParam module (biopython 1.79)
4.	Hydrophobicity (GRAVY)	0.289	Computed by ProtParam module (biopython 1.79)
5.	Hydrophobic Moment	0.622	Computed by ProtParam module (biopython 1.79)
6.	Isoelectric Point	8.748	Computed by ProtParam module (biopython 1.79)
7.	Charge (at pH 7)	1.875	Computed by ProtParam module (biopython 1.79)
8.	Secondary Structure Fraction	0.266, 0.109, 0.391 [Helix, Turn, Sheet]	Computed by ProtParam module (biopython 1.79)
9.	Aromaticity	0.047	Computed by ProtParam module (biopython 1.79)
10.	Molar Extinction Coefficient (cysteine\|cystine)	2980, 3105	Computed by ProtParam module (biopython 1.79)

4 Activity Details

4.1 Target Organism(s)

C.albicans, S.aureus (Gram-positive)

4.2 Antimicrobial Activity

Amphibian defense peptide, Antibiotic, Antimicrobial, Fungicide, Anti-MRSA, Anti-candida, Anti-gram-Positive

4.3 Enzymatic Activity

Not found

4.4 Inhibitory Effect

Not found

4.5 Other Biological Activity

Cytolysis, Hemolytic, Non-ribosomal

Activity data manually curated from Literature and UniProt

5 Database Cross-references

5.1 Literature Database

5.1.1 PubMed

Citation 1: Hoffmann W, Richter K, Kreil G, et al. A novel peptide designated PYLa and its precursor as predicted from cloned mRNA of Xenopus laevis skin. EMBO J. 1983;2(5):711-4. Published 1983. doi:10.1002/j.1460-2075.1983.tb01489.x

PMID: 6688991

Citation 2: Giovannini MG, Poulter L, Gibson BW, et al. Biosynthesis and degradation of peptides derived from Xenopus laevis prohormones. Biochem J. 1987;243(1):113-20. Published 1987 Apr 1. doi:10.1042/bj2430113

PMID: 3606567

Citation 3: Moore KS, Bevins CL, Brasseur MM, et al. Antimicrobial peptides in the stomach of Xenopus laevis. J Biol Chem. 1991;266(29):19851-7. Published 1991 Oct 15. doi:

PMID: 1717472

Citation 4: Hou F, Li J, Pan P, et al. Isolation and characterisation of a new antimicrobial peptide from the skin of Xenopus laevis. Int J Antimicrob Agents. 2011;38(6):510-5. Published 2011 Dec. doi:10.1016/j.ijantimicag.2011.07.012

PMID: 22014884

5.2 Protein Sequence Databases

UniProt: Q91826

5.3 3D Structure Databases

No PDB Ids found

AlphaFoldDB: Q91826

5.4 Nucleotide Sequence Databases

Sl. no.	Accession(s)	Access Link(s)
1.	M12498	GenBank \|\| EMBL

CCDS: Not found

RefSeq: NP_001081314.1

5.5 Protein-Protein Interaction Databases

STRING: Not found

IntAct: Not found

MINT: Not found

DIP: Not found

BioGRID: Not found

5.6 Ligand Databases

BindingDB: Not found

DrugBank: Not found

ChEMBL: Not found

5.7 Family & Domain Databases

InterPro: Not found

PANTHER: Not found

PROSITE: Not found

5.8 Genome Annotation Databases

Ensembl: Not found

KEGG: xla:397770

5.9 Phylogenomic Databases

GeneTree: Not found

5.10 Enzyme & Pathway Databases

BRENDA: Not found

BioCyc: Not found

5.11 Protein-RNA Interaction Databases

RNAct: Not found

Download