AMPDB_1043 | Peptide leucine arginine

PEPTIDE SUMMARY

Peptide leucine arginine

1 General Description

AMPDB ID: AMPDB_1043

Protein Names: Peptide leucine arginine (pLR)

Protein Family: Frog skin active peptide (FSAP) family; Brevinin subfamily

Gene Name: Nil

Source Organism: Lithobates pipiens (Northern leopard frog) (Rana pipiens)

Protein Length: 62 AA

Protein Existence: Evidence at protein level

2 Protein Sequence & Composition

2.1 Sequence

MFTLKKSLLLLFFLGTISSSLCEQERDSDDEDQGEVTEQVVKRLVRGCWTKSYPPKPCFVRG

FASTA format

2.2 Composition

Counts of Amino Acids

'A': 0, 'R': 4, 'N': 0, 'D': 4, 'C': 3, 'Q': 3, 'E': 5, 'G': 4, 'H': 0, 'I': 1, 'L': 8, 'K': 5, 'M': 1, 'F': 4, 'P': 3, 'S': 6, 'T': 4, 'W': 1, 'Y': 1, 'V': 5

Frequencies of Amino Acids

'A': 0%, 'R': 6.45%, 'N': 0%, 'D': 6.45%, 'C': 4.84%, 'Q': 4.84%, 'E': 8.06%, 'G': 6.45%, 'H': 0%, 'I': 1.61%, 'L': 12.9%, 'K': 8.06%, 'M': 1.61%, 'F': 6.45%, 'P': 4.84%, 'S': 9.68%, 'T': 6.45%, 'W': 1.61%, 'Y': 1.61%, 'V': 8.06%

Missing Amino Acid(s)

A, H, N

Most Occurring Amino Acid(s)

Less Occurring Amino Acid(s)

I, M, W, Y

Hydrophobic Amino Acid(s) Count

Hydrophilic Amino Acid(s) Count

Basic Amino Acid(s) Count

Acidic Amino Acid(s) Count

Modified Amino Acid(s) Count

Modified Amino Acid(s) Frequencies

Computed by biopython (version 1.79) & proteinAnalysis (version 1)

3 Physicochemical Properties

Sl. No.	Properties	Values	Reference
1.	Molecular Mass	7113.21 Da	Computed by ProtParam module (biopython 1.79)
2.	Aliphatic Index	80	Computed by ProtParam module (biopython 1.79)
3.	Instability Index (Half Life)	34.265	Computed by ProtParam module (biopython 1.79)
4.	Hydrophobicity (GRAVY)	-0.31	Computed by ProtParam module (biopython 1.79)
5.	Hydrophobic Moment	0.802	Computed by ProtParam module (biopython 1.79)
6.	Isoelectric Point	6.456	Computed by ProtParam module (biopython 1.79)
7.	Charge (at pH 7)	-0.18	Computed by ProtParam module (biopython 1.79)
8.	Secondary Structure Fraction	0.323, 0.21, 0.226 [Helix, Turn, Sheet]	Computed by ProtParam module (biopython 1.79)
9.	Aromaticity	0.097	Computed by ProtParam module (biopython 1.79)
10.	Molar Extinction Coefficient (cysteine\|cystine)	6990, 7115	Computed by ProtParam module (biopython 1.79)

4 Activity Details

4.1 Target Organism(s)

B.megaterium, C.tropicalis (Gram-negative), M.luteus (Gram-negative), P.nicotianae (Gram-positive)

4.2 Antimicrobial Activity

Amphibian defense peptide, Antibiotic, Antimicrobial, Fungicide, Anti-gram-negative, Anti-gram-Positive

4.3 Enzymatic Activity

Not found

4.4 Inhibitory Effect

Not found

4.5 Other Biological Activity

Cytolysis, Hemolytic, Non-ribosomal

Activity data manually curated from Literature and UniProt

5 Database Cross-references

5.1 Literature Database

5.1.1 PubMed

Citation 1: Salmon AL, Cross LJ, Irvine AE, et al. Peptide leucine arginine, a potent immunomodulatory peptide isolated and structurally characterized from the skin of the Northern Leopard frog, Rana pipiens. J Biol Chem. 2001;276(13):10145-52. Published 2001 Mar 30. doi:10.1074/jbc.M009680200

PMID: 11099505

Citation 2: , . Joint British Association and Irish Association Cancer Research Meeting. Dublin, Ireland, 21-24 June 1998. Abstracts. Br J Cancer. 1998;78 Suppl 1(Suppl 1):1-78. Published 1998. doi:

PMID: 9673585

Citation 3: Mangoni ML, Papo N, Mignogna G, et al. Ranacyclins, a new family of short cyclic antimicrobial peptides: biological function, mode of action, and parameters involved in target specificity. Biochemistry. 2003;42(47):14023-35. Published 2003 Dec 2. doi:10.1021/bi034521l

PMID: 14636071

5.2 Protein Sequence Databases

UniProt: Q90WP7

5.3 3D Structure Databases

	Sl. no.	PDB ID	Method	Resolution	Access Links	3D View

AlphaFoldDB: Q90WP7

5.4 Nucleotide Sequence Databases

Sl. no.	Accession(s)	Access Link(s)
1.	AJ414584	GenBank \|\| EMBL

CCDS: Not found

RefSeq: Not found

5.5 Protein-Protein Interaction Databases

STRING: Not found

IntAct: Not found

MINT: Not found

DIP: Not found

BioGRID: Not found

5.6 Ligand Databases

BindingDB: Not found

DrugBank: Not found

ChEMBL: Not found

5.7 Family & Domain Databases

InterPro: IPR004275, IPR032019

PANTHER: Not found

PROSITE: Not found

5.8 Genome Annotation Databases

Ensembl: Not found

KEGG: Not found

5.9 Phylogenomic Databases

GeneTree: Not found

5.10 Enzyme & Pathway Databases

BRENDA: Not found

BioCyc: Not found

5.11 Protein-RNA Interaction Databases

RNAct: Not found

Download