AMPDB_1042 | Galensin
PEPTIDE SUMMARY
Galensin
1 General Description
AMPDB ID: AMPDB_1042
Protein Names: Galensin
Protein Family: Frog skin active peptide (FSAP) family; Brevinin subfamily
Gene Name: Nil
Protein Length: 72 AA
Protein Existence: Evidence at protein level
2 Protein Sequence & Composition
2.1 Sequence
MLTLKKSMLLLFFLGLVSVSLADDKREDEAEEGEDKRAAEEERNVEKRCYSAAKYPGFQEFINRKYKSSRFG
FASTA format
2.2 Composition
Counts of Amino Acids
'A': 6, 'R': 6, 'N': 2, 'D': 4, 'C': 1, 'Q': 1, 'E': 10, 'G': 4, 'H': 0, 'I': 1, 'L': 8, 'K': 8, 'M': 2, 'F': 5, 'P': 1, 'S': 6, 'T': 1, 'W': 0, 'Y': 3, 'V': 3
Frequencies of Amino Acids
'A': 8.33%, 'R': 8.33%, 'N': 2.78%, 'D': 5.56%, 'C': 1.39%, 'Q': 1.39%, 'E': 13.89%, 'G': 5.56%, 'H': 0%, 'I': 1.39%, 'L': 11.11%, 'K': 11.11%, 'M': 2.78%, 'F': 6.94%, 'P': 1.39%, 'S': 8.33%, 'T': 1.39%, 'W': 0%, 'Y': 4.17%, 'V': 4.17%
Missing Amino Acid(s)
H, W
Most Occurring Amino Acid(s)
E
Less Occurring Amino Acid(s)
C, I, P, Q, T
Hydrophobic Amino Acid(s) Count
30
Hydrophilic Amino Acid(s) Count
42
Basic Amino Acid(s) Count
14
Acidic Amino Acid(s) Count
14
Modified Amino Acid(s) Count
0
Modified Amino Acid(s) Frequencies
0
Computed by biopython (version 1.79) & proteinAnalysis (version 1)
3 Physicochemical Properties
Sl. No. Properties Values Reference
1. Molecular Mass 8370.52 Da Computed by ProtParam module (biopython 1.79)
2. Aliphatic Index 69.167 Computed by ProtParam module (biopython 1.79)
3. Instability Index (Half Life) 48.067 Computed by ProtParam module (biopython 1.79)
4. Hydrophobicity (GRAVY) -0.718 Computed by ProtParam module (biopython 1.79)
5. Hydrophobic Moment 0.542 Computed by ProtParam module (biopython 1.79)
6. Isoelectric Point 6.716 Computed by ProtParam module (biopython 1.79)
7. Charge (at pH 7) -0.049 Computed by ProtParam module (biopython 1.79)
8. Secondary Structure Fraction 0.278, 0.181, 0.361 [Helix, Turn, Sheet] Computed by ProtParam module (biopython 1.79)
9. Aromaticity 0.111 Computed by ProtParam module (biopython 1.79)
10. Molar Extinction Coefficient (cysteine|cystine) 4470, 4470 Computed by ProtParam module (biopython 1.79)
4 Activity Details
4.1 Target Organism(s)
M.luteus (Gram-negative)
4.2 Antimicrobial Activity
Amphibian defense peptide, Antibiotic, Antimicrobial, Anti-gram-negative
4.3 Enzymatic Activity
Not found
4.4 Inhibitory Effect
Not found
4.5 Other Biological Activity
Non-hemolytic, Non-ribosomal
Activity data manually curated from Literature and UniProt
5 Database Cross-references
5.1 Literature Database
5.1.1 PubMed
No PMID found
5.2 Protein Sequence Databases
UniProt: Q90W78
5.3 3D Structure Databases
No PDB Ids found
AlphaFoldDB: Q90W78
5.4 Nucleotide Sequence Databases
Sl. no. Accession(s) Access Link(s)
1. AJ318759 GenBank || EMBL
CCDS: Not found
RefSeq: Not found
5.5 Protein-Protein Interaction Databases
STRING: Not found
IntAct: Not found
MINT: Not found
DIP: Not found
BioGRID: Not found
5.6 Ligand Databases
BindingDB: Not found
DrugBank: Not found
ChEMBL: Not found
5.7 Family & Domain Databases
InterPro: IPR004275
PANTHER: Not found
PROSITE: Not found
5.8 Genome Annotation Databases
Ensembl: Not found
KEGG: Not found
5.9 Phylogenomic Databases
GeneTree: Not found
5.10 Enzyme & Pathway Databases
BRENDA: Not found
BioCyc: Not found
5.11 Protein-RNA Interaction Databases
RNAct: Not found




© 2023 B&BL, DoAS, IIIT-A, UP-211015, India