AMPDB_1039 | Defensin-A

PEPTIDE SUMMARY

Defensin-A

1 General Description

AMPDB ID: AMPDB_1039

Protein Names: Defensin-A (DefA) (GmDefA)

Protein Family: Invertebrate defensin family; Type 1 subfamily

Gene Name: Nil

Source Organism: Glossina morsitans morsitans (Savannah tsetse fly)

Protein Length: 87 AA

Protein Existence: Evidence at protein level

2 Protein Sequence & Composition

2.1 Sequence

MKFYLVLAFLTLCAVAVTALPAGDETRIDLETLEEDLRLVDGAQVTGELKRDKRVTCNIGEWVCVAHCNSKSKKSGYCSRGVCYCTN

FASTA format

2.2 Composition

Counts of Amino Acids

'A': 7, 'R': 5, 'N': 3, 'D': 5, 'C': 7, 'Q': 1, 'E': 6, 'G': 6, 'H': 1, 'I': 2, 'L': 10, 'K': 6, 'M': 1, 'F': 2, 'P': 1, 'S': 4, 'T': 7, 'W': 1, 'Y': 3, 'V': 9

Frequencies of Amino Acids

'A': 8.05%, 'R': 5.75%, 'N': 3.45%, 'D': 5.75%, 'C': 8.05%, 'Q': 1.15%, 'E': 6.9%, 'G': 6.9%, 'H': 1.15%, 'I': 2.3%, 'L': 11.49%, 'K': 6.9%, 'M': 1.15%, 'F': 2.3%, 'P': 1.15%, 'S': 4.6%, 'T': 8.05%, 'W': 1.15%, 'Y': 3.45%, 'V': 10.34%

Missing Amino Acid(s)

No Amino Acid(s) are missing in this protein

Most Occurring Amino Acid(s)

Less Occurring Amino Acid(s)

H, M, P, Q, W

Hydrophobic Amino Acid(s) Count

Hydrophilic Amino Acid(s) Count

Basic Amino Acid(s) Count

Acidic Amino Acid(s) Count

Modified Amino Acid(s) Count

Modified Amino Acid(s) Frequencies

Computed by biopython (version 1.79) & proteinAnalysis (version 1)

3 Physicochemical Properties

Sl. No.	Properties	Values	Reference
1.	Molecular Mass	9592.11 Da	Computed by ProtParam module (biopython 1.79)
2.	Aliphatic Index	91.839	Computed by ProtParam module (biopython 1.79)
3.	Instability Index (Half Life)	25.356	Computed by ProtParam module (biopython 1.79)
4.	Hydrophobicity (GRAVY)	0.045	Computed by ProtParam module (biopython 1.79)
5.	Hydrophobic Moment	0.607	Computed by ProtParam module (biopython 1.79)
6.	Isoelectric Point	7.01	Computed by ProtParam module (biopython 1.79)
7.	Charge (at pH 7)	-0.336	Computed by ProtParam module (biopython 1.79)
8.	Secondary Structure Fraction	0.31, 0.161, 0.276 [Helix, Turn, Sheet]	Computed by ProtParam module (biopython 1.79)
9.	Aromaticity	0.069	Computed by ProtParam module (biopython 1.79)
10.	Molar Extinction Coefficient (cysteine\|cystine)	9970, 10345	Computed by ProtParam module (biopython 1.79)

4 Activity Details

4.1 Target Organism(s)

Gram Positive Bacteria

4.2 Antimicrobial Activity

Antibiotic, Antimicrobial, Defensin, Anti-gram-Positive

4.3 Enzymatic Activity

Not found

4.4 Inhibitory Effect

Not found

4.5 Other Biological Activity

Non-hemolytic, Non-ribosomal

Activity data manually curated from Literature and UniProt

5 Database Cross-references

5.1 Literature Database

5.1.1 PubMed

Citation 1: Hao Z, Kasumba I, Lehane MJ, et al. Tsetse immune responses and trypanosome transmission: implications for the development of tsetse-based strategies to reduce trypanosomiasis. Proc Natl Acad Sci U S A. 2001;98(22):12648-53. Published 2001 Oct 23. doi:10.1073/pnas.221363798

PMID: 11592981

Citation 2: Boulanger N, Brun R, Ehret-Sabatier L, et al. Immunopeptides in the defense reactions of Glossina morsitans to bacterial and Trypanosoma brucei brucei infections. Insect Biochem Mol Biol. 2002;32(4):369-75. Published 2002 Apr. doi:10.1016/s0965-1748(02)00029-2

PMID: 11886771

5.2 Protein Sequence Databases

UniProt: Q8WTD4

5.3 3D Structure Databases

No PDB Ids found

AlphaFoldDB: Q8WTD4

5.4 Nucleotide Sequence Databases

Sl. no.	Accession(s)	Access Link(s)
1.	AF368907	GenBank \|\| EMBL

CCDS: Not found

RefSeq: Not found

5.5 Protein-Protein Interaction Databases

STRING: Not found

IntAct: Not found

MINT: Not found

DIP: Not found

BioGRID: Not found

5.6 Ligand Databases

BindingDB: Not found

DrugBank: Not found

ChEMBL: Not found

5.7 Family & Domain Databases

InterPro: IPR001542, IPR036574

PANTHER: Not found

PROSITE: PS51378

5.8 Genome Annotation Databases

Ensembl: Not found

KEGG: Not found

5.9 Phylogenomic Databases

GeneTree: Not found

5.10 Enzyme & Pathway Databases

BRENDA: Not found

BioCyc: Not found

5.11 Protein-RNA Interaction Databases

RNAct: Not found

Download