AMPDB_1039 | Defensin-A
PEPTIDE SUMMARY
Defensin-A
1 General Description
AMPDB ID: AMPDB_1039
Protein Names: Defensin-A (DefA) (GmDefA)
Protein Family: Invertebrate defensin family; Type 1 subfamily
Gene Name: Nil
Protein Length: 87 AA
Protein Existence: Evidence at protein level
2 Protein Sequence & Composition
2.1 Sequence
MKFYLVLAFLTLCAVAVTALPAGDETRIDLETLEEDLRLVDGAQVTGELKRDKRVTCNIGEWVCVAHCNSKSKKSGYCSRGVCYCTN
FASTA format
2.2 Composition
Counts of Amino Acids
'A': 7, 'R': 5, 'N': 3, 'D': 5, 'C': 7, 'Q': 1, 'E': 6, 'G': 6, 'H': 1, 'I': 2, 'L': 10, 'K': 6, 'M': 1, 'F': 2, 'P': 1, 'S': 4, 'T': 7, 'W': 1, 'Y': 3, 'V': 9
Frequencies of Amino Acids
'A': 8.05%, 'R': 5.75%, 'N': 3.45%, 'D': 5.75%, 'C': 8.05%, 'Q': 1.15%, 'E': 6.9%, 'G': 6.9%, 'H': 1.15%, 'I': 2.3%, 'L': 11.49%, 'K': 6.9%, 'M': 1.15%, 'F': 2.3%, 'P': 1.15%, 'S': 4.6%, 'T': 8.05%, 'W': 1.15%, 'Y': 3.45%, 'V': 10.34%
Missing Amino Acid(s)
No Amino Acid(s) are missing in this protein
Most Occurring Amino Acid(s)
L
Less Occurring Amino Acid(s)
H, M, P, Q, W
Hydrophobic Amino Acid(s) Count
39
Hydrophilic Amino Acid(s) Count
48
Basic Amino Acid(s) Count
11
Acidic Amino Acid(s) Count
12
Modified Amino Acid(s) Count
0
Modified Amino Acid(s) Frequencies
0
Computed by biopython (version 1.79) & proteinAnalysis (version 1)
3 Physicochemical Properties
Sl. No. Properties Values Reference
1. Molecular Mass 9592.11 Da Computed by ProtParam module (biopython 1.79)
2. Aliphatic Index 91.839 Computed by ProtParam module (biopython 1.79)
3. Instability Index (Half Life) 25.356 Computed by ProtParam module (biopython 1.79)
4. Hydrophobicity (GRAVY) 0.045 Computed by ProtParam module (biopython 1.79)
5. Hydrophobic Moment 0.607 Computed by ProtParam module (biopython 1.79)
6. Isoelectric Point 7.01 Computed by ProtParam module (biopython 1.79)
7. Charge (at pH 7) -0.336 Computed by ProtParam module (biopython 1.79)
8. Secondary Structure Fraction 0.31, 0.161, 0.276 [Helix, Turn, Sheet] Computed by ProtParam module (biopython 1.79)
9. Aromaticity 0.069 Computed by ProtParam module (biopython 1.79)
10. Molar Extinction Coefficient (cysteine|cystine) 9970, 10345 Computed by ProtParam module (biopython 1.79)
4 Activity Details
4.1 Target Organism(s)
Gram Positive Bacteria
4.2 Antimicrobial Activity
Antibiotic, Antimicrobial, Defensin, Anti-gram-Positive
4.3 Enzymatic Activity
Not found
4.4 Inhibitory Effect
Not found
4.5 Other Biological Activity
Non-hemolytic, Non-ribosomal
Activity data manually curated from Literature and UniProt
5 Database Cross-references
5.1 Literature Database
5.1.1 PubMed
Citation 1: Hao Z, Kasumba I, Lehane MJ, et al. Tsetse immune responses and trypanosome transmission: implications for the development of tsetse-based strategies to reduce trypanosomiasis. Proc Natl Acad Sci U S A. 2001;98(22):12648-53. Published 2001 Oct 23. doi:10.1073/pnas.221363798
PMID: 11592981
Citation 2: Boulanger N, Brun R, Ehret-Sabatier L, et al. Immunopeptides in the defense reactions of Glossina morsitans to bacterial and Trypanosoma brucei brucei infections. Insect Biochem Mol Biol. 2002;32(4):369-75. Published 2002 Apr. doi:10.1016/s0965-1748(02)00029-2
PMID: 11886771
5.2 Protein Sequence Databases
UniProt: Q8WTD4
5.3 3D Structure Databases
No PDB Ids found
AlphaFoldDB: Q8WTD4
5.4 Nucleotide Sequence Databases
Sl. no. Accession(s) Access Link(s)
1. AF368907 GenBank || EMBL
CCDS: Not found
RefSeq: Not found
5.5 Protein-Protein Interaction Databases
STRING: Not found
IntAct: Not found
MINT: Not found
DIP: Not found
BioGRID: Not found
5.6 Ligand Databases
BindingDB: Not found
DrugBank: Not found
ChEMBL: Not found
5.7 Family & Domain Databases
InterPro: IPR001542, IPR036574
PANTHER: Not found
PROSITE: PS51378
5.8 Genome Annotation Databases
Ensembl: Not found
KEGG: Not found
5.9 Phylogenomic Databases
GeneTree: Not found
5.10 Enzyme & Pathway Databases
BRENDA: Not found
BioCyc: Not found
5.11 Protein-RNA Interaction Databases
RNAct: Not found




© 2023 B&BL, DoAS, IIIT-A, UP-211015, India