AMPDB_1038 | Attacin-A

PEPTIDE SUMMARY

Attacin-A

1 General Description

AMPDB ID: AMPDB_1038

Protein Names: Attacin-A (AttA) (GmAttA)

Protein Family: Attacin sarcotoxin-2 family

Gene Name: Nil

Source Organism: Glossina morsitans morsitans (Savannah tsetse fly)

Protein Length: 208 AA

Protein Existence: Evidence at protein level

2 Protein Sequence & Composition

2.1 Sequence

MQSFKICFFISCLSVVLVKGQFGGTVSSNPNGGLDVNARLSKTIGDPNANVVGGVFAAGNTDGGPATRGAFLAANKDGHGLSLQHSKTDNFGSSLTSSAHAHLFNDKTHKLDANAFHSRTHLDNGFKFDRVGGGLRYDHVTGHGASLTASRIPQLDMNTLGLTGKANLWSSPNRATTLDLTGGVSKHFGGPFDGQTNKQIGLGLNSRF

FASTA format

2.2 Composition

Counts of Amino Acids

'A': 16, 'R': 8, 'N': 16, 'D': 13, 'C': 2, 'Q': 6, 'E': 0, 'G': 30, 'H': 10, 'I': 5, 'L': 21, 'K': 11, 'M': 2, 'F': 14, 'P': 6, 'S': 19, 'T': 16, 'W': 1, 'Y': 1, 'V': 11

Frequencies of Amino Acids

'A': 7.69%, 'R': 3.85%, 'N': 7.69%, 'D': 6.25%, 'C': 0.96%, 'Q': 2.88%, 'E': 0%, 'G': 14.42%, 'H': 4.81%, 'I': 2.4%, 'L': 10.1%, 'K': 5.29%, 'M': 0.96%, 'F': 6.73%, 'P': 2.88%, 'S': 9.13%, 'T': 7.69%, 'W': 0.48%, 'Y': 0.48%, 'V': 5.29%

Missing Amino Acid(s)

Most Occurring Amino Acid(s)

Less Occurring Amino Acid(s)

W, Y

Hydrophobic Amino Acid(s) Count

106

Hydrophilic Amino Acid(s) Count

102

Basic Amino Acid(s) Count

Acidic Amino Acid(s) Count

Modified Amino Acid(s) Count

Modified Amino Acid(s) Frequencies

Computed by biopython (version 1.79) & proteinAnalysis (version 1)

3 Physicochemical Properties

Sl. No.	Properties	Values	Reference
1.	Molecular Mass	21754.2 Da	Computed by ProtParam module (biopython 1.79)
2.	Aliphatic Index	71.779	Computed by ProtParam module (biopython 1.79)
3.	Instability Index (Half Life)	25.326	Computed by ProtParam module (biopython 1.79)
4.	Hydrophobicity (GRAVY)	-0.28	Computed by ProtParam module (biopython 1.79)
5.	Hydrophobic Moment	0.52	Computed by ProtParam module (biopython 1.79)
6.	Isoelectric Point	10.252	Computed by ProtParam module (biopython 1.79)
7.	Charge (at pH 7)	6.785	Computed by ProtParam module (biopython 1.79)
8.	Secondary Structure Fraction	0.255, 0.341, 0.188 [Helix, Turn, Sheet]	Computed by ProtParam module (biopython 1.79)
9.	Aromaticity	0.077	Computed by ProtParam module (biopython 1.79)
10.	Molar Extinction Coefficient (cysteine\|cystine)	6990, 7115	Computed by ProtParam module (biopython 1.79)

4 Activity Details

4.1 Target Organism(s)

Gram Negative Bacteria

4.2 Antimicrobial Activity

Antibiotic, Antimicrobial, Anti-gram-negative

4.3 Enzymatic Activity

Not found

4.4 Inhibitory Effect

Not found

4.5 Other Biological Activity

Hemolytic, Non-ribosomal

Activity data manually curated from Literature and UniProt

5 Database Cross-references

5.1 Literature Database

5.1.1 PubMed

Citation 1: Hao Z, Kasumba I, Lehane MJ, et al. Tsetse immune responses and trypanosome transmission: implications for the development of tsetse-based strategies to reduce trypanosomiasis. Proc Natl Acad Sci U S A. 2001;98(22):12648-53. Published 2001 Oct 23. doi:10.1073/pnas.221363798

PMID: 11592981

Citation 2: Boulanger N, Brun R, Ehret-Sabatier L, et al. Immunopeptides in the defense reactions of Glossina morsitans to bacterial and Trypanosoma brucei brucei infections. Insect Biochem Mol Biol. 2002;32(4):369-75. Published 2002 Apr. doi:10.1016/s0965-1748(02)00029-2

PMID: 11886771

5.2 Protein Sequence Databases

UniProt: Q8WTD3

5.3 3D Structure Databases

No PDB Ids found

AlphaFoldDB: Q8WTD3

5.4 Nucleotide Sequence Databases

Sl. no.	Accession(s)	Access Link(s)
1.	AF368909	GenBank \|\| EMBL

CCDS: Not found

RefSeq: Not found

5.5 Protein-Protein Interaction Databases

STRING: 37546.Q8WTD3

IntAct: Not found

MINT: Not found

DIP: Not found

BioGRID: Not found

5.6 Ligand Databases

BindingDB: Not found

DrugBank: Not found

ChEMBL: Not found

5.7 Family & Domain Databases

InterPro: IPR005521, IPR005520

PANTHER: Not found

PROSITE: Not found

5.8 Genome Annotation Databases

Ensembl: Not found

KEGG: Not found

5.9 Phylogenomic Databases

GeneTree: Not found

5.10 Enzyme & Pathway Databases

BRENDA: Not found

BioCyc: Not found

5.11 Protein-RNA Interaction Databases

RNAct: Not found

Download