AMPDB_1036 | Moronecidin
PEPTIDE SUMMARY
Moronecidin
1 General Description
AMPDB ID: AMPDB_1036
Protein Names: Moronecidin (Piscidin-1)
Protein Family: Pleurocidin family
Gene Name: Nil
Protein Length: 79 AA
Protein Existence: Evidence at protein level
2 Protein Sequence & Composition
2.1 Sequence
MKCATLFLVLSMVVLMAEPGDAFFHHIFRGIVHVGKTIHRLVTGGKAEQDQQDQQYQQEQQEQQAQQYQRFNRERAAFD
FASTA format
2.2 Composition
Counts of Amino Acids
'A': 7, 'R': 5, 'N': 1, 'D': 4, 'C': 1, 'Q': 14, 'E': 5, 'G': 5, 'H': 4, 'I': 3, 'L': 5, 'K': 3, 'M': 3, 'F': 6, 'P': 1, 'S': 1, 'T': 3, 'W': 0, 'Y': 2, 'V': 6
Frequencies of Amino Acids
'A': 8.86%, 'R': 6.33%, 'N': 1.27%, 'D': 5.06%, 'C': 1.27%, 'Q': 17.72%, 'E': 6.33%, 'G': 6.33%, 'H': 5.06%, 'I': 3.8%, 'L': 6.33%, 'K': 3.8%, 'M': 3.8%, 'F': 7.59%, 'P': 1.27%, 'S': 1.27%, 'T': 3.8%, 'W': 0%, 'Y': 2.53%, 'V': 7.59%
Missing Amino Acid(s)
W
Most Occurring Amino Acid(s)
Q
Less Occurring Amino Acid(s)
C, N, P, S
Hydrophobic Amino Acid(s) Count
36
Hydrophilic Amino Acid(s) Count
43
Basic Amino Acid(s) Count
9
Acidic Amino Acid(s) Count
12
Modified Amino Acid(s) Count
0
Modified Amino Acid(s) Frequencies
0
Computed by biopython (version 1.79) & proteinAnalysis (version 1)
3 Physicochemical Properties
Sl. No. Properties Values Reference
1. Molecular Mass 9222.42 Da Computed by ProtParam module (biopython 1.79)
2. Aliphatic Index 70.38 Computed by ProtParam module (biopython 1.79)
3. Instability Index (Half Life) 45.309 Computed by ProtParam module (biopython 1.79)
4. Hydrophobicity (GRAVY) -0.567 Computed by ProtParam module (biopython 1.79)
5. Hydrophobic Moment 0.729 Computed by ProtParam module (biopython 1.79)
6. Isoelectric Point 6.954 Computed by ProtParam module (biopython 1.79)
7. Charge (at pH 7) -0.692 Computed by ProtParam module (biopython 1.79)
8. Secondary Structure Fraction 0.278, 0.101, 0.253 [Helix, Turn, Sheet] Computed by ProtParam module (biopython 1.79)
9. Aromaticity 0.101 Computed by ProtParam module (biopython 1.79)
10. Molar Extinction Coefficient (cysteine|cystine) 2980, 2980 Computed by ProtParam module (biopython 1.79)
4 Activity Details
4.1 Target Organism(s)
Gram Negative Bacteria and Gram Positive Bacteria
4.2 Antimicrobial Activity
Antibiotic, Antimicrobial, Fungicide, Anti-HSV, Anti-gram-negative, Anti-gram-Positive
4.3 Enzymatic Activity
Not found
4.4 Inhibitory Effect
Not found
4.5 Other Biological Activity
Cytolysis, Hemolytic, Non-ribosomal
Activity data manually curated from Literature and UniProt
5 Database Cross-references
5.1 Literature Database
5.1.1 PubMed
Citation 1: Lauth X, Shike H, Burns JC, et al. Discovery and characterization of two isoforms of moronecidin, a novel antimicrobial peptide from hybrid striped bass. J Biol Chem. 2002;277(7):5030-9. Published 2002 Feb 15. doi:10.1074/jbc.M109173200
PMID: 11739390
Citation 2: Silphaduang U, Noga EJ, Noga EJ. Peptide antibiotics in mast cells of fish. Nature. 2001;414(6861):268-9. Published 2001 Nov 15. doi:10.1038/35104690
PMID: 11713517
Citation 3: Chinchar VG, Bryan L, Silphadaung U, et al. Inactivation of viruses infecting ectothermic animals by amphibian and piscine antimicrobial peptides. Virology. 2004;323(2):268-75. Published 2004 Jun 1. doi:10.1016/j.virol.2004.02.029
PMID: 15193922
Citation 4: Campagna S, Saint N, Molle G, et al. Structure and mechanism of action of the antimicrobial peptide piscidin. Biochemistry. 2007;46(7):1771-8. Published 2007 Feb 20. doi:10.1021/bi0620297
PMID: 17253775
5.2 Protein Sequence Databases
UniProt: Q8UUG0
5.3 3D Structure Databases
Sl. no. PDB ID Method Resolution Access Links 3D View
AlphaFoldDB: Q8UUG0
5.4 Nucleotide Sequence Databases
Sl. no. Accession(s) Access Link(s)
1. AF385583 GenBank || EMBL
2. AF394244 GenBank || EMBL
CCDS: Not found
RefSeq: Not found
5.5 Protein-Protein Interaction Databases
STRING: Not found
IntAct: Not found
MINT: Not found
DIP: Not found
BioGRID: Not found
5.6 Ligand Databases
BindingDB: Not found
DrugBank: Not found
ChEMBL: Not found
5.7 Family & Domain Databases
InterPro: IPR012515
PANTHER: Not found
PROSITE: Not found
5.8 Genome Annotation Databases
Ensembl: Not found
KEGG: Not found
5.9 Phylogenomic Databases
GeneTree: Not found
5.10 Enzyme & Pathway Databases
BRENDA: Not found
BioCyc: Not found
5.11 Protein-RNA Interaction Databases
RNAct: Not found




© 2023 B&BL, DoAS, IIIT-A, UP-211015, India