AMPDB_1035 | Stomoxyn
PEPTIDE SUMMARY
Stomoxyn
1 General Description
AMPDB ID: AMPDB_1035
Protein Names: Stomoxyn
Protein Family: Nil
Gene Name: Nil
Protein Length: 67 AA
Protein Existence: Evidence at protein level
2 Protein Sequence & Composition
2.1 Sequence
MNFYKYLVVLVVLVLCLSATQTEARGFRKHFNKLVKKVKHTISETAHVAKDTAVIAGSGAAVVAATG
FASTA format
2.2 Composition
Counts of Amino Acids
'A': 10, 'R': 2, 'N': 2, 'D': 1, 'C': 1, 'Q': 1, 'E': 2, 'G': 4, 'H': 3, 'I': 2, 'L': 6, 'K': 7, 'M': 1, 'F': 3, 'P': 0, 'S': 3, 'T': 6, 'W': 0, 'Y': 2, 'V': 11
Frequencies of Amino Acids
'A': 14.93%, 'R': 2.99%, 'N': 2.99%, 'D': 1.49%, 'C': 1.49%, 'Q': 1.49%, 'E': 2.99%, 'G': 5.97%, 'H': 4.48%, 'I': 2.99%, 'L': 8.96%, 'K': 10.45%, 'M': 1.49%, 'F': 4.48%, 'P': 0%, 'S': 4.48%, 'T': 8.96%, 'W': 0%, 'Y': 2.99%, 'V': 16.42%
Missing Amino Acid(s)
P, W
Most Occurring Amino Acid(s)
V
Less Occurring Amino Acid(s)
C, D, M, Q
Hydrophobic Amino Acid(s) Count
37
Hydrophilic Amino Acid(s) Count
30
Basic Amino Acid(s) Count
3
Acidic Amino Acid(s) Count
12
Modified Amino Acid(s) Count
0
Modified Amino Acid(s) Frequencies
0
Computed by biopython (version 1.79) & proteinAnalysis (version 1)
3 Physicochemical Properties
Sl. No. Properties Values Reference
1. Molecular Mass 7173.5 Da Computed by ProtParam module (biopython 1.79)
2. Aliphatic Index 109.104 Computed by ProtParam module (biopython 1.79)
3. Instability Index (Half Life) 10.127 Computed by ProtParam module (biopython 1.79)
4. Hydrophobicity (GRAVY) 0.464 Computed by ProtParam module (biopython 1.79)
5. Hydrophobic Moment 0.799 Computed by ProtParam module (biopython 1.79)
6. Isoelectric Point 10.551 Computed by ProtParam module (biopython 1.79)
7. Charge (at pH 7) 6.209 Computed by ProtParam module (biopython 1.79)
8. Secondary Structure Fraction 0.358, 0.134, 0.284 [Helix, Turn, Sheet] Computed by ProtParam module (biopython 1.79)
9. Aromaticity 0.075 Computed by ProtParam module (biopython 1.79)
10. Molar Extinction Coefficient (cysteine|cystine) 2980, 2980 Computed by ProtParam module (biopython 1.79)
4 Activity Details
4.1 Target Organism(s)
Gram Negative Bacteria and Gram Positive Bacteria
4.2 Antimicrobial Activity
Antibiotic, Antimicrobial, Fungicide, Anti-gram-negative, Anti-gram-Positive
4.3 Enzymatic Activity
Not found
4.4 Inhibitory Effect
Not found
4.5 Other Biological Activity
Hemolytic, Non-ribosomal
Activity data manually curated from Literature and UniProt
5 Database Cross-references
5.1 Literature Database
5.1.1 PubMed
Citation 1: Boulanger N, Munks RJ, Hamilton JV, et al. Epithelial innate immunity. A novel antimicrobial peptide with antiparasitic activity in the blood-sucking insect Stomoxys calcitrans. J Biol Chem. 2002;277(51):49921-6. Published 2002 Dec 20. doi:10.1074/jbc.M206296200
PMID: 12372834
Citation 2: Landon C, Meudal H, Boulanger N, et al. Solution structures of stomoxyn and spinigerin, two insect antimicrobial peptides with an alpha-helical conformation. Biopolymers. 2006;81(2):92-103. Published 2006 Feb 5. doi:10.1002/bip.20370
PMID: 16170803
5.2 Protein Sequence Databases
UniProt: Q8T9R8
5.3 3D Structure Databases
Sl. no. PDB ID Method Resolution Access Links 3D View
AlphaFoldDB: Q8T9R8
5.4 Nucleotide Sequence Databases
Sl. no. Accession(s) Access Link(s)
1. AF467987 GenBank || EMBL
CCDS: Not found
RefSeq: Not found
5.5 Protein-Protein Interaction Databases
STRING: Not found
IntAct: Not found
MINT: Not found
DIP: Not found
BioGRID: Not found
5.6 Ligand Databases
BindingDB: Not found
DrugBank: Not found
ChEMBL: Not found
5.7 Family & Domain Databases
InterPro: IPR021037
PANTHER: Not found
PROSITE: Not found
5.8 Genome Annotation Databases
Ensembl: Not found
KEGG: Not found
5.9 Phylogenomic Databases
GeneTree: Not found
5.10 Enzyme & Pathway Databases
BRENDA: Not found
BioCyc: Not found
5.11 Protein-RNA Interaction Databases
RNAct: Not found




© 2023 B&BL, DoAS, IIIT-A, UP-211015, India