AMPDB_1025 | Acanthoscurrin-1

PEPTIDE SUMMARY

Acanthoscurrin-1

1 General Description

AMPDB ID: AMPDB_1025

Protein Names: Acanthoscurrin-1

Protein Family: Nil

Gene Name: acantho1

Source Organism: Acanthoscurria gomesiana (Tarantula spider) (Phormictopus pheopygus)

Protein Length: 156 AA

Protein Existence: Evidence at protein level

2 Protein Sequence & Composition

2.1 Sequence

MAFRMKLVVCIVLLSTLAVMSSADVYKGGGGGRYGGGRYGGGGGYGGGLGGGGLGGGGLGGGKGLGGGGLGGGGLGGGGLGGGGLGGGKGLGGGGLGGGGLGGGGLGGGGLGGGKGLGGGGLGGGGLGGGRGGGYGGGGGYGGGYGGGYGGGKYKG

FASTA format

2.2 Composition

Counts of Amino Acids

'A': 3, 'R': 4, 'N': 0, 'D': 1, 'C': 1, 'Q': 0, 'E': 0, 'G': 97, 'H': 0, 'I': 1, 'L': 20, 'K': 7, 'M': 3, 'F': 1, 'P': 0, 'S': 3, 'T': 1, 'W': 0, 'Y': 9, 'V': 5

Frequencies of Amino Acids

'A': 1.92%, 'R': 2.56%, 'N': 0%, 'D': 0.64%, 'C': 0.64%, 'Q': 0%, 'E': 0%, 'G': 62.18%, 'H': 0%, 'I': 0.64%, 'L': 12.82%, 'K': 4.49%, 'M': 1.92%, 'F': 0.64%, 'P': 0%, 'S': 1.92%, 'T': 0.64%, 'W': 0%, 'Y': 5.77%, 'V': 3.21%

Missing Amino Acid(s)

E, H, N, P, Q, W

Most Occurring Amino Acid(s)

Less Occurring Amino Acid(s)

C, D, F, I, T

Hydrophobic Amino Acid(s) Count

130

Hydrophilic Amino Acid(s) Count

Basic Amino Acid(s) Count

Acidic Amino Acid(s) Count

Modified Amino Acid(s) Count

Modified Amino Acid(s) Frequencies

Computed by biopython (version 1.79) & proteinAnalysis (version 1)

3 Physicochemical Properties

Sl. No.	Properties	Values	Reference
1.	Molecular Mass	12749.2 Da	Computed by ProtParam module (biopython 1.79)
2.	Aliphatic Index	63.718	Computed by ProtParam module (biopython 1.79)
3.	Instability Index (Half Life)	53.512	Computed by ProtParam module (biopython 1.79)
4.	Hydrophobicity (GRAVY)	0.099	Computed by ProtParam module (biopython 1.79)
5.	Hydrophobic Moment	0.313	Computed by ProtParam module (biopython 1.79)
6.	Isoelectric Point	10.401	Computed by ProtParam module (biopython 1.79)
7.	Charge (at pH 7)	9.927	Computed by ProtParam module (biopython 1.79)
8.	Secondary Structure Fraction	0.231, 0.641, 0.167 [Helix, Turn, Sheet]	Computed by ProtParam module (biopython 1.79)
9.	Aromaticity	0.064	Computed by ProtParam module (biopython 1.79)
10.	Molar Extinction Coefficient (cysteine\|cystine)	13410, 13410	Computed by ProtParam module (biopython 1.79)

4 Activity Details

4.1 Target Organism(s)

E.coli (Gram-negative)

4.2 Antimicrobial Activity

Antibiotic, Antimicrobial, Fungicide, Anti-candida, Anti-gram-negative

4.3 Enzymatic Activity

Not found

4.4 Inhibitory Effect

Not found

4.5 Other Biological Activity

Non-hemolytic, Non-ribosomal

Activity data manually curated from Literature and UniProt

5 Database Cross-references

5.1 Literature Database

5.1.1 PubMed

Citation 1: Lorenzini DM, da Silva PI Jr, FogaÃ§a AC, et al. Acanthoscurrin: a novel glycine-rich antimicrobial peptide constitutively expressed in the hemocytes of the spider Acanthoscurria gomesiana. Dev Comp Immunol. 2003;27(9):781-91. Published 2003 Oct. doi:10.1016/s0145-305x(03)00058-2

PMID: 12818635

5.2 Protein Sequence Databases

UniProt: Q8I948

5.3 3D Structure Databases

No PDB Ids found

AlphaFoldDB: Q8I948

5.4 Nucleotide Sequence Databases

Sl. no.	Accession(s)	Access Link(s)
1.	AJ508925	GenBank \|\| EMBL

CCDS: Not found

RefSeq: Not found

5.5 Protein-Protein Interaction Databases

STRING: Not found

IntAct: Not found

MINT: Not found

DIP: Not found

BioGRID: Not found

5.6 Ligand Databases

BindingDB: Not found

DrugBank: Not found

ChEMBL: Not found

5.7 Family & Domain Databases

InterPro: Not found

PANTHER: Not found

PROSITE: Not found

5.8 Genome Annotation Databases

Ensembl: Not found

KEGG: Not found

5.9 Phylogenomic Databases

GeneTree: Not found

5.10 Enzyme & Pathway Databases

BRENDA: Not found

BioCyc: Not found

5.11 Protein-RNA Interaction Databases

RNAct: Not found

Download