AMPDB_1023 | Floral defensin-like protein 2

PEPTIDE SUMMARY

Floral defensin-like protein 2

1 General Description

AMPDB ID: AMPDB_1023

Protein Names: Floral defensin-like protein 2 (PhD2)

Protein Family: DEFL family

Gene Name: D2

Source Organism: Petunia hybrida (Petunia)

Protein Length: 101 AA

Protein Existence: Evidence at protein level

2 Protein Sequence & Composition

2.1 Sequence

MARSICFFAVAILALMLFAAYETEAGTCKAECPTWEGICINKAPCVKCCKAQPEKFTDGHCSKILRRCLCTKPCATEEATATLANEVKTMAEALVEEDMME

FASTA format

2.2 Composition

Counts of Amino Acids

'A': 16, 'R': 3, 'N': 2, 'D': 2, 'C': 11, 'Q': 1, 'E': 12, 'G': 3, 'H': 1, 'I': 5, 'L': 7, 'K': 8, 'M': 5, 'F': 4, 'P': 4, 'S': 2, 'T': 9, 'W': 1, 'Y': 1, 'V': 4

Frequencies of Amino Acids

'A': 15.84%, 'R': 2.97%, 'N': 1.98%, 'D': 1.98%, 'C': 10.89%, 'Q': 0.99%, 'E': 11.88%, 'G': 2.97%, 'H': 0.99%, 'I': 4.95%, 'L': 6.93%, 'K': 7.92%, 'M': 4.95%, 'F': 3.96%, 'P': 3.96%, 'S': 1.98%, 'T': 8.91%, 'W': 0.99%, 'Y': 0.99%, 'V': 3.96%

Missing Amino Acid(s)

No Amino Acid(s) are missing in this protein

Most Occurring Amino Acid(s)

Less Occurring Amino Acid(s)

H, Q, W, Y

Hydrophobic Amino Acid(s) Count

Hydrophilic Amino Acid(s) Count

Basic Amino Acid(s) Count

Acidic Amino Acid(s) Count

Modified Amino Acid(s) Count

Modified Amino Acid(s) Frequencies

Computed by biopython (version 1.79) & proteinAnalysis (version 1)

3 Physicochemical Properties

Sl. No.	Properties	Values	Reference
1.	Molecular Mass	11049 Da	Computed by ProtParam module (biopython 1.79)
2.	Aliphatic Index	73.663	Computed by ProtParam module (biopython 1.79)
3.	Instability Index (Half Life)	50.937	Computed by ProtParam module (biopython 1.79)
4.	Hydrophobicity (GRAVY)	0.176	Computed by ProtParam module (biopython 1.79)
5.	Hydrophobic Moment	0.626	Computed by ProtParam module (biopython 1.79)
6.	Isoelectric Point	4.86	Computed by ProtParam module (biopython 1.79)
7.	Charge (at pH 7)	-3.574	Computed by ProtParam module (biopython 1.79)
8.	Secondary Structure Fraction	0.218, 0.109, 0.396 [Helix, Turn, Sheet]	Computed by ProtParam module (biopython 1.79)
9.	Aromaticity	0.059	Computed by ProtParam module (biopython 1.79)
10.	Molar Extinction Coefficient (cysteine\|cystine)	6990, 7615	Computed by ProtParam module (biopython 1.79)

4 Activity Details

4.1 Target Organism(s)

F.oxysporum

4.2 Antimicrobial Activity

Antimicrobial, Fungicide, Plant defense

4.3 Enzymatic Activity

Not found

4.4 Inhibitory Effect

Not found

4.5 Other Biological Activity

Non-hemolytic, Non-ribosomal

Activity data manually curated from Literature and UniProt

5 Database Cross-references

5.1 Literature Database

5.1.1 PubMed

Citation 1: Lay FT, Brugliera F, Anderson MA, et al. Isolation and properties of floral defensins from ornamental tobacco and petunia. Plant Physiol. 2003;131(3):1283-93. Published 2003 Mar. doi:10.1104/pp.102.016626

PMID: 12644678

5.2 Protein Sequence Databases

UniProt: Q8H6Q0

5.3 3D Structure Databases

No PDB Ids found

AlphaFoldDB: Q8H6Q0

5.4 Nucleotide Sequence Databases

Sl. no.	Accession(s)	Access Link(s)
1.	AF507976	GenBank \|\| EMBL

CCDS: Not found

RefSeq: Not found

5.5 Protein-Protein Interaction Databases

STRING: Not found

IntAct: Not found

MINT: Not found

DIP: Not found

BioGRID: Not found

5.6 Ligand Databases

BindingDB: Not found

DrugBank: Not found

ChEMBL: Not found

5.7 Family & Domain Databases

InterPro: IPR036574

PANTHER: Not found

PROSITE: Not found

5.8 Genome Annotation Databases

Ensembl: Not found

KEGG: Not found

5.9 Phylogenomic Databases

GeneTree: Not found

5.10 Enzyme & Pathway Databases

BRENDA: Not found

BioCyc: Not found

5.11 Protein-RNA Interaction Databases

RNAct: Not found

Download