AMPDB_1022 | Flower-specific defensin

PEPTIDE SUMMARY

Flower-specific defensin

1 General Description

AMPDB ID: AMPDB_1022

Protein Names: Flower-specific defensin (NaD1)

Protein Family: DEFL family

Gene Name: D1

Source Organism: Nicotiana alata (Winged tobacco) (Persian tobacco)

Protein Length: 105 AA

Protein Existence: Evidence at protein level

2 Protein Sequence & Composition

2.1 Sequence

MARSLCFMAFAILAMMLFVAYEVQARECKTESNTFPGICITKPPCRKACISEKFTDGHCSKILRRCLCTKPCVFDEKMTKTGAEILAEEAKTLAAALLEEEIMDN

FASTA format

2.2 Composition

Counts of Amino Acids

'A': 13, 'R': 5, 'N': 2, 'D': 3, 'C': 9, 'Q': 1, 'E': 11, 'G': 3, 'H': 1, 'I': 7, 'L': 9, 'K': 9, 'M': 6, 'F': 6, 'P': 4, 'S': 4, 'T': 8, 'W': 0, 'Y': 1, 'V': 3

Frequencies of Amino Acids

'A': 12.38%, 'R': 4.76%, 'N': 1.9%, 'D': 2.86%, 'C': 8.57%, 'Q': 0.95%, 'E': 10.48%, 'G': 2.86%, 'H': 0.95%, 'I': 6.67%, 'L': 8.57%, 'K': 8.57%, 'M': 5.71%, 'F': 5.71%, 'P': 3.81%, 'S': 3.81%, 'T': 7.62%, 'W': 0%, 'Y': 0.95%, 'V': 2.86%

Missing Amino Acid(s)

Most Occurring Amino Acid(s)

Less Occurring Amino Acid(s)

H, Q, Y

Hydrophobic Amino Acid(s) Count

Hydrophilic Amino Acid(s) Count

Basic Amino Acid(s) Count

Acidic Amino Acid(s) Count

Modified Amino Acid(s) Count

Modified Amino Acid(s) Frequencies

Computed by biopython (version 1.79) & proteinAnalysis (version 1)

3 Physicochemical Properties

Sl. No.	Properties	Values	Reference
1.	Molecular Mass	11721.9 Da	Computed by ProtParam module (biopython 1.79)
2.	Aliphatic Index	80.095	Computed by ProtParam module (biopython 1.79)
3.	Instability Index (Half Life)	61.251	Computed by ProtParam module (biopython 1.79)
4.	Hydrophobicity (GRAVY)	0.137	Computed by ProtParam module (biopython 1.79)
5.	Hydrophobic Moment	0.626	Computed by ProtParam module (biopython 1.79)
6.	Isoelectric Point	6.959	Computed by ProtParam module (biopython 1.79)
7.	Charge (at pH 7)	-0.452	Computed by ProtParam module (biopython 1.79)
8.	Secondary Structure Fraction	0.248, 0.124, 0.371 [Helix, Turn, Sheet]	Computed by ProtParam module (biopython 1.79)
9.	Aromaticity	0.067	Computed by ProtParam module (biopython 1.79)
10.	Molar Extinction Coefficient (cysteine\|cystine)	1490, 1990	Computed by ProtParam module (biopython 1.79)

4 Activity Details

4.1 Target Organism(s)

F.oxysporum, H.armigera, Lepidopteran

4.2 Antimicrobial Activity

Antimicrobial, Fungicide, Plant defense

4.3 Enzymatic Activity

Not found

4.4 Inhibitory Effect

Not found

4.5 Other Biological Activity

Non-hemolytic, Non-ribosomal

Activity data manually curated from Literature and UniProt

5 Database Cross-references

5.1 Literature Database

5.1.1 PubMed

Citation 1: Lay FT, Brugliera F, Anderson MA, et al. Isolation and properties of floral defensins from ornamental tobacco and petunia. Plant Physiol. 2003;131(3):1283-93. Published 2003 Mar. doi:10.1104/pp.102.016626

PMID: 12644678

Citation 2: Lay FT, Schirra HJ, Scanlon MJ, et al. The three-dimensional solution structure of NaD1, a new floral defensin from Nicotiana alata and its application to a homology model of the crop defense protein alfAFP. J Mol Biol. 2003;325(1):175-88. Published 2003 Jan 3. doi:10.1016/s0022-2836(02)01103-8

PMID: 12473460

5.2 Protein Sequence Databases

UniProt: Q8GTM0

5.3 3D Structure Databases

	Sl. no.	PDB ID	Method	Resolution	Access Links	3D View

AlphaFoldDB: Q8GTM0

5.4 Nucleotide Sequence Databases

Sl. no.	Accession(s)	Access Link(s)
1.	AF509566	GenBank \|\| EMBL

CCDS: Not found

RefSeq: Not found

5.5 Protein-Protein Interaction Databases

STRING: Not found

IntAct: Not found

MINT: Not found

DIP: Not found

BioGRID: Not found

5.6 Ligand Databases

BindingDB: Not found

DrugBank: Not found

ChEMBL: Not found

5.7 Family & Domain Databases

InterPro: IPR008176, IPR003614, IPR036574

PANTHER: Not found

PROSITE: PS00940

5.8 Genome Annotation Databases

Ensembl: Not found

KEGG: Not found

5.9 Phylogenomic Databases

GeneTree: Not found

5.10 Enzyme & Pathway Databases

BRENDA: Not found

BioCyc: Not found

5.11 Protein-RNA Interaction Databases

RNAct: Not found

Download