AMPDB_1020 | Defensin

PEPTIDE SUMMARY

Defensin

1 General Description

AMPDB ID: AMPDB_1020

Protein Names: Defensin (Varisin A1)

Protein Family: Invertebrate defensin family; Type 2 subfamily

Gene Name: VSNA1

Source Organism: Dermacentor variabilis (American dog tick)

Protein Length: 74 AA

Protein Existence: Evidence at protein level

2 Protein Sequence & Composition

2.1 Sequence

MRGLCICLVFLLVCGLVSATAAAPAESEVAHLRVRRGFGCPLNQGACHNHCRSIRRRGGYCSGIIKQTCTCYRN

FASTA format

2.2 Composition

Counts of Amino Acids

'A': 7, 'R': 9, 'N': 3, 'D': 0, 'C': 9, 'Q': 2, 'E': 2, 'G': 8, 'H': 3, 'I': 4, 'L': 7, 'K': 1, 'M': 1, 'F': 2, 'P': 2, 'S': 4, 'T': 3, 'W': 0, 'Y': 2, 'V': 5

Frequencies of Amino Acids

'A': 9.46%, 'R': 12.16%, 'N': 4.05%, 'D': 0%, 'C': 12.16%, 'Q': 2.7%, 'E': 2.7%, 'G': 10.81%, 'H': 4.05%, 'I': 5.41%, 'L': 9.46%, 'K': 1.35%, 'M': 1.35%, 'F': 2.7%, 'P': 2.7%, 'S': 5.41%, 'T': 4.05%, 'W': 0%, 'Y': 2.7%, 'V': 6.76%

Missing Amino Acid(s)

D, W

Most Occurring Amino Acid(s)

C, R

Less Occurring Amino Acid(s)

K, M

Hydrophobic Amino Acid(s) Count

Hydrophilic Amino Acid(s) Count

Basic Amino Acid(s) Count

Acidic Amino Acid(s) Count

Modified Amino Acid(s) Count

Modified Amino Acid(s) Frequencies

Computed by biopython (version 1.79) & proteinAnalysis (version 1)

3 Physicochemical Properties

Sl. No.	Properties	Values	Reference
1.	Molecular Mass	8040.5 Da	Computed by ProtParam module (biopython 1.79)
2.	Aliphatic Index	87.027	Computed by ProtParam module (biopython 1.79)
3.	Instability Index (Half Life)	68.226	Computed by ProtParam module (biopython 1.79)
4.	Hydrophobicity (GRAVY)	0.208	Computed by ProtParam module (biopython 1.79)
5.	Hydrophobic Moment	0.72	Computed by ProtParam module (biopython 1.79)
6.	Isoelectric Point	9.065	Computed by ProtParam module (biopython 1.79)
7.	Charge (at pH 7)	7.714	Computed by ProtParam module (biopython 1.79)
8.	Secondary Structure Fraction	0.27, 0.23, 0.23 [Helix, Turn, Sheet]	Computed by ProtParam module (biopython 1.79)
9.	Aromaticity	0.054	Computed by ProtParam module (biopython 1.79)
10.	Molar Extinction Coefficient (cysteine\|cystine)	2980, 3480	Computed by ProtParam module (biopython 1.79)

4 Activity Details

4.1 Target Organism(s)

Gram Negative Bacteria and Gram Positive Bacteria

4.2 Antimicrobial Activity

Antibiotic, Antimicrobial, Defensin, Anti-gram-negative, Anti-gram-Positive

4.3 Enzymatic Activity

Not found

4.4 Inhibitory Effect

Not found

4.5 Other Biological Activity

Non-hemolytic, Non-ribosomal

Activity data manually curated from Literature and UniProt

5 Database Cross-references

5.1 Literature Database

5.1.1 PubMed

Citation 1: Ceraul SM, Sonenshine DE, Ratzlaff RE, et al. An arthropod defensin expressed by the hemocytes of the American dog tick, Dermacentor variabilis (Acari: Ixodidae). Insect Biochem Mol Biol. 2003;33(11):1099-103. Published 2003 Nov. doi:10.1016/s0965-1748(03)00122-x

PMID: 14563361

Citation 2: Johns R, Sonenshine DE, Hynes WL, et al. Identification of a defensin from the hemolymph of the American dog tick, Dermacentor variabilis. Insect Biochem Mol Biol. 2001;31(9):857-65. Published 2001 Jul 26. doi:10.1016/s0965-1748(01)00031-5

PMID: 11439245

5.2 Protein Sequence Databases

UniProt: Q86QI5

5.3 3D Structure Databases

No PDB Ids found

AlphaFoldDB: Q86QI5

5.4 Nucleotide Sequence Databases

Sl. no.	Accession(s)	Access Link(s)
1.	AY181027	GenBank \|\| EMBL

CCDS: Not found

RefSeq: Not found

5.5 Protein-Protein Interaction Databases

STRING: Not found

IntAct: Not found

MINT: Not found

DIP: Not found

BioGRID: Not found

5.6 Ligand Databases

BindingDB: Not found

DrugBank: Not found

ChEMBL: Not found

5.7 Family & Domain Databases

InterPro: IPR001542, IPR036574

PANTHER: Not found

PROSITE: PS51378

5.8 Genome Annotation Databases

Ensembl: Not found

KEGG: Not found

5.9 Phylogenomic Databases

GeneTree: Not found

5.10 Enzyme & Pathway Databases

BRENDA: Not found

BioCyc: Not found

5.11 Protein-RNA Interaction Databases

RNAct: Not found

Download