AMPDB_1018 | Plasticin-B1

1 General Description

AMPDB ID: AMPDB_1018

Protein Names: Plasticin-B1 (PTC-B1) (Dermaseptin PBN2) (DRP-PBN2) (PBN2 KF)

Protein Family: Frog skin active peptide (FSAP) family; Plasticin subfamily

Gene Name: Nil

Source Organism: Phyllomedusa bicolor (Two-colored leaf frog) (Rana bicolor)

Protein Length: 70 AA

Protein Existence: Evidence at protein level

2 Protein Sequence & Composition

MAFLKKSLFLVLFLALVPLSICEEKKSEEENEEKQEDDQSEEKRGLVTSLIKGAGKLLGGLFGSVTGGQS

FASTA format

Counts of Amino Acids

'A': 3, 'R': 1, 'N': 1, 'D': 2, 'C': 1, 'Q': 3, 'E': 10, 'G': 8, 'H': 0, 'I': 2, 'L': 12, 'K': 8, 'M': 1, 'F': 4, 'P': 1, 'S': 7, 'T': 2, 'W': 0, 'Y': 0, 'V': 4

Frequencies of Amino Acids

'A': 4.29%, 'R': 1.43%, 'N': 1.43%, 'D': 2.86%, 'C': 1.43%, 'Q': 4.29%, 'E': 14.29%, 'G': 11.43%, 'H': 0%, 'I': 2.86%, 'L': 17.14%, 'K': 11.43%, 'M': 1.43%, 'F': 5.71%, 'P': 1.43%, 'S': 10%, 'T': 2.86%, 'W': 0%, 'Y': 0%, 'V': 5.71%

Missing Amino Acid(s)

H, W, Y

Most Occurring Amino Acid(s)

Less Occurring Amino Acid(s)

C, M, N, P, R

Hydrophobic Amino Acid(s) Count

Hydrophilic Amino Acid(s) Count

Basic Amino Acid(s) Count

Acidic Amino Acid(s) Count

Modified Amino Acid(s) Count

Modified Amino Acid(s) Frequencies

Computed by biopython (version 1.79) & proteinAnalysis (version 1)

3 Physicochemical Properties

Sl. No.	Properties	Values	Reference
1.	Molecular Mass	7601.75 Da	Computed by ProtParam module (biopython 1.79)
2.	Aliphatic Index	98.857	Computed by ProtParam module (biopython 1.79)
3.	Instability Index (Half Life)	60.654	Computed by ProtParam module (biopython 1.79)
4.	Hydrophobicity (GRAVY)	-0.159	Computed by ProtParam module (biopython 1.79)
5.	Hydrophobic Moment	0.589	Computed by ProtParam module (biopython 1.79)
6.	Isoelectric Point	4.566	Computed by ProtParam module (biopython 1.79)
7.	Charge (at pH 7)	-3.048	Computed by ProtParam module (biopython 1.79)
8.	Secondary Structure Fraction	0.314, 0.243, 0.371 [Helix, Turn, Sheet]	Computed by ProtParam module (biopython 1.79)
9.	Aromaticity	0.057	Computed by ProtParam module (biopython 1.79)
10.	Molar Extinction Coefficient (cysteine\|cystine)	0, 0	Computed by ProtParam module (biopython 1.79)

4.1 Target Organism(s)

E.coli (Gram-negative)

4.2 Antimicrobial Activity

Amphibian defense peptide, Antibiotic, Antimicrobial, Anti-gram-negative

4.3 Enzymatic Activity

4.4 Inhibitory Effect

4.5 Other Biological Activity

Cytolysis, Cytotoxin, Hemolytic, Synergistic peptide, Non-ribosomal

Activity data manually curated from Literature and UniProt

5 Database Cross-references

5.1 Literature Database

Citation 1: Vanhoye D, Bruston F, Nicolas P, et al. Antimicrobial peptides from hylid and ranin frogs originated from a 150-million-year-old ancestral precursor with a conserved signal peptide but a hypermutable antimicrobial domain. Eur J Biochem. 2003;270(9):2068-81. Published 2003 May. doi:10.1046/j.1432-1033.2003.03584.x

PMID: 12709067

Citation 2: Vanhoye D, Bruston F, El Amri S, et al. Membrane association, electrostatic sequestration, and cytotoxicity of Gly-Leu-rich peptide orthologs with differing functions. Biochemistry. 2004;43(26):8391-409. Published 2004 Jul 6. doi:10.1021/bi0493158

PMID: 15222751

Citation 3: El Amri C, Lacombe C, Zimmerman K, et al. The plasticins: membrane adsorption, lipid disorders, and biological activity. Biochemistry. 2006;45(48):14285-97. Published 2006 Dec 5. doi:10.1021/bi060999o

PMID: 17128968

Citation 4: Amiche M, Ladram A, Nicolas P, et al. A consistent nomenclature of antimicrobial peptides isolated from frogs of the subfamily Phyllomedusinae. Peptides. 2008;29(11):2074-82. Published 2008 Nov. doi:10.1016/j.peptides.2008.06.017

PMID: 18644413

Citation 5: Carlier L, Joanne P, KhemtÃ©mourian L, et al. Investigating the role of GXXXG motifs in helical folding and self-association of plasticins, Gly/Leu-rich antimicrobial peptides. Biophys Chem. 2015;196:40-52. Published 2015 Jan. doi:10.1016/j.bpc.2014.09.004

PMID: 25291467

5.2 Protein Sequence Databases

5.3 3D Structure Databases

AlphaFoldDB: Q800R4

5.4 Nucleotide Sequence Databases

Sl. no.	Accession(s)	Access Link(s)
1.	AY218783	GenBank \|\| EMBL

RefSeq: Not found

5.5 Protein-Protein Interaction Databases

STRING: Not found

IntAct: Not found

BioGRID: Not found

5.6 Ligand Databases

BindingDB: Not found

DrugBank: Not found

ChEMBL: Not found

5.7 Family & Domain Databases

InterPro: IPR004275, IPR016322

PANTHER: Not found

PROSITE: Not found

5.8 Genome Annotation Databases

Ensembl: Not found

5.9 Phylogenomic Databases

GeneTree: Not found

5.10 Enzyme & Pathway Databases

BRENDA: Not found

BioCyc: Not found

5.11 Protein-RNA Interaction Databases

RNAct: Not found

Download