AMPDB_1012 | Peptide BmKb1

PEPTIDE SUMMARY

Peptide BmKb1

1 General Description

AMPDB ID: AMPDB_1012

Protein Names: Peptide BmKb1 (Antimicrobial peptide-like protein) (BmKb1`) (BmKb1*) (Non-disulfide-bridged peptide 4.2) (NDBP-4.2) (Non-disulfide-bridged peptide 4.3) (NDBP-4.3) (Toxin peptide 6)

Protein Family: Non-disulfide-bridged peptide (NDBP) superfamily; Short antimicrobial peptide (group 4) family

Gene Name: Nil

Source Organism: Mesobuthus martensii (Manchurian scorpion) (Buthus martensii)

Protein Length: 74 AA

Protein Existence: Evidence at protein level

2 Protein Sequence & Composition

2.1 Sequence

MEIKYLLTVFLVLLIVSDHCQAFLFSLIPSAISGLISAFKGRRKRDLNGYIDHFKNFRKRDAELEELLSKLPIY

FASTA format

2.2 Composition

Counts of Amino Acids

'A': 4, 'R': 5, 'N': 2, 'D': 4, 'C': 1, 'Q': 1, 'E': 4, 'G': 3, 'H': 2, 'I': 7, 'L': 13, 'K': 6, 'M': 1, 'F': 6, 'P': 2, 'S': 6, 'T': 1, 'W': 0, 'Y': 3, 'V': 3

Frequencies of Amino Acids

'A': 5.41%, 'R': 6.76%, 'N': 2.7%, 'D': 5.41%, 'C': 1.35%, 'Q': 1.35%, 'E': 5.41%, 'G': 4.05%, 'H': 2.7%, 'I': 9.46%, 'L': 17.57%, 'K': 8.11%, 'M': 1.35%, 'F': 8.11%, 'P': 2.7%, 'S': 8.11%, 'T': 1.35%, 'W': 0%, 'Y': 4.05%, 'V': 4.05%

Missing Amino Acid(s)

Most Occurring Amino Acid(s)

Less Occurring Amino Acid(s)

C, M, Q, T

Hydrophobic Amino Acid(s) Count

Hydrophilic Amino Acid(s) Count

Basic Amino Acid(s) Count

Acidic Amino Acid(s) Count

Modified Amino Acid(s) Count

Modified Amino Acid(s) Frequencies

Computed by biopython (version 1.79) & proteinAnalysis (version 1)

3 Physicochemical Properties

Sl. No.	Properties	Values	Reference
1.	Molecular Mass	8616.22 Da	Computed by ProtParam module (biopython 1.79)
2.	Aliphatic Index	122.568	Computed by ProtParam module (biopython 1.79)
3.	Instability Index (Half Life)	21.96	Computed by ProtParam module (biopython 1.79)
4.	Hydrophobicity (GRAVY)	0.234	Computed by ProtParam module (biopython 1.79)
5.	Hydrophobic Moment	0.604	Computed by ProtParam module (biopython 1.79)
6.	Isoelectric Point	9.634	Computed by ProtParam module (biopython 1.79)
7.	Charge (at pH 7)	3.122	Computed by ProtParam module (biopython 1.79)
8.	Secondary Structure Fraction	0.432, 0.176, 0.297 [Helix, Turn, Sheet]	Computed by ProtParam module (biopython 1.79)
9.	Aromaticity	0.122	Computed by ProtParam module (biopython 1.79)
10.	Molar Extinction Coefficient (cysteine\|cystine)	4470, 4470	Computed by ProtParam module (biopython 1.79)

4 Activity Details

4.1 Target Organism(s)

B.subtilis (Gram-positive), E.coli (Gram-negative), M.luteus (Gram-negative), S.aureus (Gram-positive)

4.2 Antimicrobial Activity

Antibiotic, Antimicrobial, Anti-gram-negative, Anti-gram-Positive

4.3 Enzymatic Activity

Not found

4.4 Inhibitory Effect

Not found

4.5 Other Biological Activity

Non-hemolytic, Non-ribosomal

Activity data manually curated from Literature and UniProt

5 Database Cross-references

5.1 Literature Database

5.1.1 PubMed

Citation 1: Zeng XC, Wang SX, Zhu Y, et al. Identification and functional characterization of novel scorpion venom peptides with no disulfide bridge from Buthus martensii Karsch. Peptides. 2004;25(2):143-50. Published 2004 Feb. doi:10.1016/j.peptides.2003.12.003

PMID: 15062994

Citation 2: Luo F, Zeng XC, Hahin R, et al. Genomic organization of four novel nondisulfide-bridged peptides from scorpion Mesobuthus martensii Karsch: gaining insight into evolutionary mechanism. Peptides. 2005;26(12):2427-33. Published 2005 Dec. doi:10.1016/j.peptides.2005.06.008

PMID: 16040157

Citation 3: Zeng XC, Corzo G, Hahin R, et al. Scorpion venom peptides without disulfide bridges. IUBMB Life. 2005;57(1):13-21. Published 2005 Jan. doi:10.1080/15216540500058899

PMID: 16036557

Citation 4: Almaaytah A, Albalas Q, Albalas Q. Scorpion venom peptides with no disulfide bridges: a review. Peptides. 2014;51:35-45. Published 2014 Jan. doi:10.1016/j.peptides.2013.10.021

PMID: 24184590

5.2 Protein Sequence Databases

UniProt: Q718F4

5.3 3D Structure Databases

No PDB Ids found

AlphaFoldDB: Q718F4

5.4 Nucleotide Sequence Databases

Sl. no.	Accession(s)	Access Link(s)
1.	AF543048	GenBank \|\| EMBL
2.	AF159979	GenBank \|\| EMBL
3.	AY700566	GenBank \|\| EMBL

CCDS: Not found

RefSeq: Not found

5.5 Protein-Protein Interaction Databases

STRING: Not found

IntAct: Not found

MINT: Not found

DIP: Not found

BioGRID: Not found

5.6 Ligand Databases

BindingDB: Not found

DrugBank: Not found

ChEMBL: Not found

5.7 Family & Domain Databases

InterPro: Not found

PANTHER: Not found

PROSITE: Not found

5.8 Genome Annotation Databases

Ensembl: Not found

KEGG: Not found

5.9 Phylogenomic Databases

GeneTree: Not found

5.10 Enzyme & Pathway Databases

BRENDA: Not found

BioCyc: Not found

5.11 Protein-RNA Interaction Databases

RNAct: Not found

Download