AMPDB_1008 | Gallinacin-9

1 General Description

AMPDB ID: AMPDB_1008

Protein Names: Gallinacin-9 (Gal-9) (Beta-defensin 9) (Gallinacin-6) (Gal-6)

Protein Family: Beta-defensin family

Gene Name: GAL9

Source Organism: Gallus gallus (Chicken)

Protein Length: 67 AA

Protein Existence: Evidence at transcript level

2 Protein Sequence & Composition

MRILFFLVAVLFFLFQAAPAYSQEDADTLACRQSHGSCSFVACRAPSVDIGTCRGGKLKCCKWAPSS

FASTA format

Counts of Amino Acids

'A': 9, 'R': 4, 'N': 0, 'D': 3, 'C': 6, 'Q': 3, 'E': 1, 'G': 4, 'H': 1, 'I': 2, 'L': 6, 'K': 3, 'M': 1, 'F': 6, 'P': 3, 'S': 7, 'T': 2, 'W': 1, 'Y': 1, 'V': 4

Frequencies of Amino Acids

'A': 13.43%, 'R': 5.97%, 'N': 0%, 'D': 4.48%, 'C': 8.96%, 'Q': 4.48%, 'E': 1.49%, 'G': 5.97%, 'H': 1.49%, 'I': 2.99%, 'L': 8.96%, 'K': 4.48%, 'M': 1.49%, 'F': 8.96%, 'P': 4.48%, 'S': 10.45%, 'T': 2.99%, 'W': 1.49%, 'Y': 1.49%, 'V': 5.97%

Missing Amino Acid(s)

Most Occurring Amino Acid(s)

Less Occurring Amino Acid(s)

E, H, M, W, Y

Hydrophobic Amino Acid(s) Count

Hydrophilic Amino Acid(s) Count

Basic Amino Acid(s) Count

Acidic Amino Acid(s) Count

Modified Amino Acid(s) Count

Modified Amino Acid(s) Frequencies

Computed by biopython (version 1.79) & proteinAnalysis (version 1)

3 Physicochemical Properties

Sl. No.	Properties	Values	Reference
1.	Molecular Mass	7278.51 Da	Computed by ProtParam module (biopython 1.79)
2.	Aliphatic Index	77.313	Computed by ProtParam module (biopython 1.79)
3.	Instability Index (Half Life)	53.722	Computed by ProtParam module (biopython 1.79)
4.	Hydrophobicity (GRAVY)	0.381	Computed by ProtParam module (biopython 1.79)
5.	Hydrophobic Moment	0.37	Computed by ProtParam module (biopython 1.79)
6.	Isoelectric Point	8.385	Computed by ProtParam module (biopython 1.79)
7.	Charge (at pH 7)	2.718	Computed by ProtParam module (biopython 1.79)
8.	Secondary Structure Fraction	0.299, 0.209, 0.254 [Helix, Turn, Sheet]	Computed by ProtParam module (biopython 1.79)
9.	Aromaticity	0.119	Computed by ProtParam module (biopython 1.79)
10.	Molar Extinction Coefficient (cysteine\|cystine)	6990, 7365	Computed by ProtParam module (biopython 1.79)

4.1 Target Organism(s)

C.albicans, C.jejuni (Gram-negative), C.perfringens (Gram-positive), S.aureus (Gram-positive), S.typhimurium

4.2 Antimicrobial Activity

Antibiotic, Antimicrobial, Defensin, Fungicide, Anti-candida, Anti-yeast, Anti-gram-negative, Anti-gram-Positive

4.3 Enzymatic Activity

4.4 Inhibitory Effect

4.5 Other Biological Activity

Non-hemolytic, Non-ribosomal

Activity data manually curated from Literature and UniProt

5 Database Cross-references

5.1 Literature Database

Citation 1: Lynn DJ, Higgs R, Gaines S, et al. Bioinformatic discovery and initial characterisation of nine novel antimicrobial peptide genes in the chicken. Immunogenetics. 2004;56(3):170-7. Published 2004 Jun. doi:10.1007/s00251-004-0675-0

PMID: 15148642

Citation 2: Xiao Y, Hughes AL, Ando J, et al. A genome-wide screen identifies a single beta-defensin gene cluster in the chicken: implications for the origin and evolution of mammalian defensins. BMC Genomics. 2004;5(1):56. Published 2004 Aug 13. doi:10.1186/1471-2164-5-56

PMID: 15310403

Citation 3: van Dijk A, Veldhuizen EJ, Kalkhove SI, et al. The beta-defensin gallinacin-6 is expressed in the chicken digestive tract and has antimicrobial activity against food-borne pathogens. Antimicrob Agents Chemother. 2007;51(3):912-22. Published 2007 Mar. doi:10.1128/AAC.00568-06

PMID: 17194828

Citation 4: Subedi K, Isobe N, Nishibori M, et al. Changes in the expression of gallinacins, antimicrobial peptides, in ovarian follicles during follicular growth and in response to lipopolysaccharide in laying hens (Gallus domesticus). Reproduction. 2007;133(1):127-33. Published 2007 Jan. doi:10.1530/REP-06-0083

PMID: 17244739

5.2 Protein Sequence Databases

5.3 3D Structure Databases

AlphaFoldDB: Q6QLR1

5.4 Nucleotide Sequence Databases

Sl. no.	Accession(s)	Access Link(s)
1.	AY534894	GenBank \|\| EMBL
2.	AY621311	GenBank \|\| EMBL
3.	AY621324	GenBank \|\| EMBL
4.	DQ677640	GenBank \|\| EMBL
5.	DQ858306	GenBank \|\| EMBL
6.	DQ858319	GenBank \|\| EMBL
7.	DQ858332	GenBank \|\| EMBL
8.	DQ858346	GenBank \|\| EMBL