AMPDB_1003 | Gallinacin-13

PEPTIDE SUMMARY

Gallinacin-13

1 General Description

AMPDB ID: AMPDB_1003

Protein Names: Gallinacin-13 (Gal-13) (Beta-defensin 13) (Gallinacin-11) (Gal-11)

Protein Family: Beta-defensin family

Gene Name: GAL13

Source Organism: Gallus gallus (Chicken)

Protein Length: 89 AA

Protein Existence: Evidence at transcript level

2 Protein Sequence & Composition

2.1 Sequence

MRILQLLFAIVVILLLQDAPARGFSDSQLCRNNHGHCRRLCFHMESWAGSCMNGRLRCCRFSTKQPFSNPKHSVLHTAEQDPSPSLGGT

FASTA format

2.2 Composition

Counts of Amino Acids

'A': 5, 'R': 8, 'N': 4, 'D': 3, 'C': 6, 'Q': 5, 'E': 2, 'G': 6, 'H': 5, 'I': 3, 'L': 11, 'K': 2, 'M': 3, 'F': 5, 'P': 5, 'S': 9, 'T': 3, 'W': 1, 'Y': 0, 'V': 3

Frequencies of Amino Acids

'A': 5.62%, 'R': 8.99%, 'N': 4.49%, 'D': 3.37%, 'C': 6.74%, 'Q': 5.62%, 'E': 2.25%, 'G': 6.74%, 'H': 5.62%, 'I': 3.37%, 'L': 12.36%, 'K': 2.25%, 'M': 3.37%, 'F': 5.62%, 'P': 5.62%, 'S': 10.11%, 'T': 3.37%, 'W': 1.12%, 'Y': 0%, 'V': 3.37%

Missing Amino Acid(s)

Most Occurring Amino Acid(s)

Less Occurring Amino Acid(s)

Hydrophobic Amino Acid(s) Count

Hydrophilic Amino Acid(s) Count

Basic Amino Acid(s) Count

Acidic Amino Acid(s) Count

Modified Amino Acid(s) Count

Modified Amino Acid(s) Frequencies

Computed by biopython (version 1.79) & proteinAnalysis (version 1)

3 Physicochemical Properties

Sl. No.	Properties	Values	Reference
1.	Molecular Mass	9996.58 Da	Computed by ProtParam module (biopython 1.79)
2.	Aliphatic Index	76.742	Computed by ProtParam module (biopython 1.79)
3.	Instability Index (Half Life)	64.384	Computed by ProtParam module (biopython 1.79)
4.	Hydrophobicity (GRAVY)	-0.2	Computed by ProtParam module (biopython 1.79)
5.	Hydrophobic Moment	0.524	Computed by ProtParam module (biopython 1.79)
6.	Isoelectric Point	8.91	Computed by ProtParam module (biopython 1.79)
7.	Charge (at pH 7)	5.085	Computed by ProtParam module (biopython 1.79)
8.	Secondary Structure Fraction	0.258, 0.27, 0.236 [Helix, Turn, Sheet]	Computed by ProtParam module (biopython 1.79)
9.	Aromaticity	0.067	Computed by ProtParam module (biopython 1.79)
10.	Molar Extinction Coefficient (cysteine\|cystine)	5500, 5875	Computed by ProtParam module (biopython 1.79)

4 Activity Details

4.1 Target Organism(s)

E.coli (Gram-negative), L.monocytogenes (Gram-positive), S.pyogenes (Gram-positive), S.typhimurium

4.2 Antimicrobial Activity

Antibiotic, Antimicrobial, Defensin, Anti-gram-negative, Anti-gram-Positive

4.3 Enzymatic Activity

Not found

4.4 Inhibitory Effect

Not found

4.5 Other Biological Activity

Non-hemolytic, Non-ribosomal

Activity data manually curated from Literature and UniProt

5 Database Cross-references

5.1 Literature Database

5.1.1 PubMed

Citation 1: Xiao Y, Hughes AL, Ando J, et al. A genome-wide screen identifies a single beta-defensin gene cluster in the chicken: implications for the origin and evolution of mammalian defensins. BMC Genomics. 2004;5(1):56. Published 2004 Aug 13. doi:10.1186/1471-2164-5-56

PMID: 15310403

Citation 2: Higgs R, Lynn DJ, Gaines S, et al. The synthetic form of a novel chicken beta-defensin identified in silico is predominantly active against intestinal pathogens. Immunogenetics. 2005;57(1-2):90-8. Published 2005 Apr. doi:10.1007/s00251-005-0777-3

PMID: 15744537

Citation 3: Subedi K, Isobe N, Nishibori M, et al. Changes in the expression of gallinacins, antimicrobial peptides, in ovarian follicles during follicular growth and in response to lipopolysaccharide in laying hens (Gallus domesticus). Reproduction. 2007;133(1):127-33. Published 2007 Jan. doi:10.1530/REP-06-0083

PMID: 17244739

5.2 Protein Sequence Databases

UniProt: Q6IV18

5.3 3D Structure Databases

No PDB Ids found

AlphaFoldDB: Q6IV18

5.4 Nucleotide Sequence Databases

Sl. no.	Accession(s)	Access Link(s)
1.	AY621315	GenBank \|\| EMBL
2.	AY621328	GenBank \|\| EMBL
3.	AY701473	GenBank \|\| EMBL
4.	DQ677644	GenBank \|\| EMBL
5.	DQ858310	GenBank \|\| EMBL
6.	DQ858323	GenBank \|\| EMBL
7.	DQ858336	GenBank \|\| EMBL
8.	DQ858350	GenBank \|\| EMBL