AMPDB_1002 | Gallinacin-4

1 General Description

AMPDB ID: AMPDB_1002

Protein Names: Gallinacin-4 (Gal-4) (Beta-defensin 4) (Gallinacin-7) (Gal-7)

Protein Family: Beta-defensin family

Gene Name: GAL4

Source Organism: Gallus gallus (Chicken)

Protein Length: 63 AA

Protein Existence: Evidence at transcript level

2 Protein Sequence & Composition

MKILCFFIVLLFVAVHGAVGFSRSPRYHMQCGYRGTFCTPGKCPHGNAYLGLCRPKYSCCRWL

FASTA format

Counts of Amino Acids

'A': 3, 'R': 5, 'N': 1, 'D': 0, 'C': 7, 'Q': 1, 'E': 0, 'G': 7, 'H': 3, 'I': 2, 'L': 6, 'K': 3, 'M': 2, 'F': 5, 'P': 4, 'S': 3, 'T': 2, 'W': 1, 'Y': 4, 'V': 4

Frequencies of Amino Acids

'A': 4.76%, 'R': 7.94%, 'N': 1.59%, 'D': 0%, 'C': 11.11%, 'Q': 1.59%, 'E': 0%, 'G': 11.11%, 'H': 4.76%, 'I': 3.17%, 'L': 9.52%, 'K': 4.76%, 'M': 3.17%, 'F': 7.94%, 'P': 6.35%, 'S': 4.76%, 'T': 3.17%, 'W': 1.59%, 'Y': 6.35%, 'V': 6.35%

Missing Amino Acid(s)

D, E

Most Occurring Amino Acid(s)

C, G

Less Occurring Amino Acid(s)

N, Q, W

Hydrophobic Amino Acid(s) Count

Hydrophilic Amino Acid(s) Count

Basic Amino Acid(s) Count

Acidic Amino Acid(s) Count

Modified Amino Acid(s) Count

Modified Amino Acid(s) Frequencies

Computed by biopython (version 1.79) & proteinAnalysis (version 1)

3 Physicochemical Properties

Sl. No.	Properties	Values	Reference
1.	Molecular Mass	7162.61 Da	Computed by ProtParam module (biopython 1.79)
2.	Aliphatic Index	72.698	Computed by ProtParam module (biopython 1.79)
3.	Instability Index (Half Life)	38.444	Computed by ProtParam module (biopython 1.79)
4.	Hydrophobicity (GRAVY)	0.308	Computed by ProtParam module (biopython 1.79)
5.	Hydrophobic Moment	0.551	Computed by ProtParam module (biopython 1.79)
6.	Isoelectric Point	9.441	Computed by ProtParam module (biopython 1.79)
7.	Charge (at pH 7)	7.833	Computed by ProtParam module (biopython 1.79)
8.	Secondary Structure Fraction	0.349, 0.238, 0.175 [Helix, Turn, Sheet]	Computed by ProtParam module (biopython 1.79)
9.	Aromaticity	0.159	Computed by ProtParam module (biopython 1.79)
10.	Molar Extinction Coefficient (cysteine\|cystine)	11460, 11835	Computed by ProtParam module (biopython 1.79)

4.1 Target Organism(s)

4.2 Antimicrobial Activity

Antibiotic, Antimicrobial, Defensin

4.3 Enzymatic Activity

4.4 Inhibitory Effect

4.5 Other Biological Activity

Non-hemolytic, Non-ribosomal

Activity data manually curated from Literature and UniProt

5 Database Cross-references

5.1 Literature Database

Citation 1: Xiao Y, Hughes AL, Ando J, et al. A genome-wide screen identifies a single beta-defensin gene cluster in the chicken: implications for the origin and evolution of mammalian defensins. BMC Genomics. 2004;5(1):56. Published 2004 Aug 13. doi:10.1186/1471-2164-5-56

PMID: 15310403

Citation 2: Lynn DJ, Higgs R, Gaines S, et al. Bioinformatic discovery and initial characterisation of nine novel antimicrobial peptide genes in the chicken. Immunogenetics. 2004;56(3):170-7. Published 2004 Jun. doi:10.1007/s00251-004-0675-0

PMID: 15148642

Citation 3: Milona P, Townes CL, Bevan RM, et al. The chicken host peptides, gallinacins 4, 7, and 9 have antimicrobial activity against Salmonella serovars. Biochem Biophys Res Commun. 2007;356(1):169-74. Published 2007 Apr 27. doi:10.1016/j.bbrc.2007.02.098

PMID: 17346671

Citation 4: Subedi K, Isobe N, Nishibori M, et al. Changes in the expression of gallinacins, antimicrobial peptides, in ovarian follicles during follicular growth and in response to lipopolysaccharide in laying hens (Gallus domesticus). Reproduction. 2007;133(1):127-33. Published 2007 Jan. doi:10.1530/REP-06-0083

PMID: 17244739

5.2 Protein Sequence Databases

5.3 3D Structure Databases

AlphaFoldDB: Q6GXJ1

5.4 Nucleotide Sequence Databases

Sl. no.	Accession(s)	Access Link(s)
1.	AY621306	GenBank \|\| EMBL
2.	AY621319	GenBank \|\| EMBL
3.	AY534895	GenBank \|\| EMBL
4.	DQ677635	GenBank \|\| EMBL
5.	DQ858301	GenBank \|\| EMBL
6.	DQ858314	GenBank \|\| EMBL
7.	DQ858327	GenBank \|\| EMBL
8.	DQ858341	GenBank \|\| EMBL
9.	DQ673442	GenBank \|\| EMBL

RefSeq: NP_001001610.1

5.5 Protein-Protein Interaction Databases

IntAct: Not found

BioGRID: Not found

5.6 Ligand Databases

BindingDB: Not found

DrugBank: Not found

ChEMBL: Not found

5.7 Family & Domain Databases

InterPro: Not found

PANTHER: Not found

PROSITE: Not found

5.8 Genome Annotation Databases

Ensembl: Not found

KEGG: gga:414342

5.9 Phylogenomic Databases

GeneTree: Not found

5.10 Enzyme & Pathway Databases

BRENDA: Not found

BioCyc: Not found

5.11 Protein-RNA Interaction Databases

RNAct: Not found

Download