IAMP76 | Antimicrobial peptide Alo-3
PEPTIDE SUMMARY
Antimicrobial peptide Alo-3
1 General Description
IAMPDB ID: IAMP76
Peptide Name: Antimicrobial peptide Alo-3
Gene Name: Not available
Source: Acrocinus longimanus (Giant harlequin beetle)
Taxonomy (Order): Coleoptera
Peptide Existence: Evidence at protein level
2 Peptide Sequence & Composition
2.1 Sequence
CIKNGNGCQPNGSQGNCCSGYCHKQPGWVAGYCRRK
FASTA format
2.2 Composition
Length
36 Amino Acid Residues
Molecular Formula
C158H315N55O83S6
Counts of Amino Acids
'A': 1, 'C': 6, 'D': 0, 'E': 0, 'F': 0, 'G': 7, 'H': 1, 'I': 1, 'K': 3, 'L': 0, 'M': 0, 'N': 4, 'P': 2, 'Q': 3, 'R': 2, 'S': 2, 'T': 0, 'V': 1, 'W': 1, 'Y': 2
Frequencies of Amino Acids
'A': 2.78%, 'C': 16.67%, 'D': 0%, 'E': 0%, 'F': 0%, 'G': 19.44%, 'H': 2.78%, 'I': 2.78%, 'K': 8.33%, 'L': 0%, 'M': 0%, 'N': 11.11%, 'P': 5.56%, 'Q': 8.33%, 'R': 5.56%, 'S': 5.56%, 'T': 0%, 'V': 2.78%, 'W': 2.78%, 'Y': 5.56%
Missing Amino Acid(s)
D, E, F, L, M, T
Most Occurring Amino Acid(s)
G
Less Occurring Amino Acid(s)
A, H, I, V, W
Hydrophobic Amino Acid(s) Count
13
Hydrophilic Amino Acid(s) Count
23
Basic Amino Acid(s) Count
6
Acidic Amino Acid(s) Count
0
Modified Amino Acid(s) Count
0
Modified Amino Acid(s) Frequencies
0
Computed by proteinAnalysis (version 2)
3 Physicochemical Properties
Sl. No. Properties Values Reference
1. Molecular Mass 3875.38 Da Computed by proteinAnalysis (version 2)
2. Aliphatic Index 21.6667 Computed by proteinAnalysis (version 2)
3. Instability Index (Half Life) 37.7528 Computed by proteinAnalysis (version 2)
4. Hydrophobicity (GRAVY) -0.944444 Computed by proteinAnalysis (version 2)
5. Hydrophobic Moment 0.278009 Computed by proteinAnalysis (version 2)
6. Isoelectric Point 8.87034 Computed by proteinAnalysis (version 2)
7. Net Charge 4.71445 Computed by proteinAnalysis (version 2)
8. Secondary Structure Fraction 0.139, 0.417, 0.028 [Helix, Turn, Sheet] Computed by proteinAnalysis (version 2)
9. Aromaticity 0.0833333 Computed by proteinAnalysis (version 2)
10. Molar Extinction Coefficient (cysteine|cystine) 8480, 8855 Computed by proteinAnalysis (version 2)
11. Mass Shift 30.1006 Computed by proteinAnalysis (version 2)
4 Structural Class of the Peptide
beta
Computed by proteinAnalysis (version 2)
5 Activity Information
Antimicrobial Activities: Antimicrobial [PMID: 14661954]; Fungicide [UniProt]
Enzymatic Activities: Not available
Inhibitory Activities: Not available
Other Biological Activities: Knottin [PMID: 14661954]

Target Organisms (Gram Positive Bacteria): Not available
Target Organisms (Gram Negative Bacteria): Not available
Target Organisms (Fungi): Not available
Target Organisms (Virus): Not available
Target Organisms (Protozoa): Not available
Exception Target Organisms: Not available

Binding Target: Not available
Mechanism of Action: Not available

Hemolytic Activity: Not available
Cytolytic Activity: Not available
Other Lytic Info: Not available

Toxicity: These peptides have a broad spectrum of antimicrobial activity with a low mammalian cell cytotoxicity [PMID: 14661954]

Related Assays Info: Not available
Data manually curated from Literature/UniProt
6 Database Cross-references
6.1 Literature Database
6.1.1 PubMed
Citation 1: Barbault F, Landon C, Guenneugues M, et al. Solution structure of Alo-3: a new knottin-type antifungal peptide from the insect Acrocinus longimanus. Biochemistry. 2003;42(49):14434-42. Published 2003 Dec 16. doi:10.1021/bi035400o
PMID: 14661954
6.2 3D Structure Databases
Sl. no. PDB ID Method Resolution Access Links 3D View
6.3 Protein Database
UniProt: P83653




© 2024, B&BL, DoAS, IIIT-A, India